KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0647Help
Entry
CKCE_0647         CDS       T02413                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKCE_0647 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKCE_0647 (trpC)
Enzymes [BR:kci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CKCE_0647 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(673895..674707)
Genome map
AA seq 270 aa AA seqDB search
MNDLLKKIIDVKKDEILASKKNCNEQELLLKINNNDIRSFEKAIHKKIQNGYPAIIAEIK
KASPSKGILSKNFNPSLFATSYEENGAACISVLTDQQFFQGSSEYLKQVKSACSLPILRK
DFIIDDYQILESRAMGADCILLIVSALEKNKLYELENIALELGMDVLVETHNLKEVEIAL
NLKTPLIGINNRNLRNFKTDIKITIDLINFIPEDKIIITESGINSPEDLKFMRENKVNAF
LIGEYFMKSDNPGEQLKTLLSNNIAKTNYI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcttcttaaaaagataatagatgtaaaaaaagatgaaatattggcatctaaa
aaaaattgcaatgaacaagaactattattaaaaattaataataacgatatacgctctttt
gaaaaagcaattcataaaaaaatccaaaatgggtatcctgctattatagcagaaataaaa
aaagcttctccttctaaaggtattttaagtaaaaattttaacccctcattatttgcaacc
agttatgaggaaaacggtgctgcctgtatatctgtattaacagaccaacaatttttccaa
ggttcttcagaatatttaaaacaggtcaaatcagcttgttcattaccaatacttaggaaa
gactttataattgatgactatcaaatattagaatcaagagcaatgggagcagattgcata
ttacttatagtctcagcactagaaaaaaataaactttatgaattagaaaatatagcacta
gaactaggaatggatgttctagtcgaaacacataatttaaaagaagttgaaatagcctta
aatctaaaaactcctttgattggaattaataatagaaatttaagaaattttaaaactgat
ataaaaattacgatagacctcattaactttataccagaagacaaaattataatcacagaa
agtggcataaattcaccagaagatttgaaatttatgagagaaaataaagttaacgcattt
ttaataggagaatatttcatgaaatcagataacccaggagaacagctgaaaacactatta
tcaaataacattgcaaaaacaaattacatttaa

DBGET integrated database retrieval system