KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0752Help
Entry
CKCE_0752         CDS       T02413                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKCE_0752 (recR)
DNA repair and recombination proteins [BR:kci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CKCE_0752 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785080..785694
Genome map
AA seq 204 aa AA seqDB search
MEEQQISEPEPLINLIKALKRLPGIGIRSARRIAYHLMQYDLQGANSLSIALSEATGSLQ
HCISCNSFSETDLCVTCSSSFRDKSLLCIVETPSDLINLEASHGYKGLYYVLMGRISPLD
GIGPKELNFHKISERINKGGIEEVIIATGFTAEGETTAQFLIDMLVPFGIKTSRLARGVP
AGSELEYIDAGTIAWALMDRKSNL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcagcaaataagtgaacctgagcctttaattaatctaattaaggctttaaaa
cgccttcctggaataggtataaggtcagctaggagaatagcttaccatttgatgcaatat
gacttgcaaggtgcaaattcactaagtattgctttgtcagaagctactggtagtttgcaa
cattgtattagttgtaatagtttttctgaaacagacttatgcgttacatgttccagttct
ttcagagataagagtttgttatgtatagtcgaaactccatctgatttaattaatttagaa
gcaagtcatggttataagggtttgtattatgtattaatgggcagaatatcgccattggat
ggcattggtccaaaagaattaaattttcataaaatttctgaaagaataaacaaaggtggt
atagaagaggtgatcattgccactggatttactgctgaaggtgaaacgacagctcagttt
ttaattgatatgttggtgccttttggcataaagactagtcgtttggcaagaggagttcct
gcaggtagcgaattggaatatatcgatgcaggaactatagcttgggctttgatggaccgt
aagtctaatttataa

DBGET integrated database retrieval system