KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0115Help
Entry
Kcr_0115          CDS       T00668                                 

Definition
hypothetical protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_0115
   00620 Pyruvate metabolism
    Kcr_0115
   00640 Propanoate metabolism
    Kcr_0115
Enzymes [BR:kcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Kcr_0115
Lipid biosynthesis proteins [BR:kcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kcr_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(118883..119575)
Genome map
AA seq 230 aa AA seqDB search
MSSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLK
IVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVEL
IIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGM
EPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaagggacctattgcttaaagctaaggagaacgggaggaagtccctcctggag
cacgaggccaagtatttcatctccagctatgggattccggtgactaatataagattggcg
aagagtgaggaagaggccgtcaatttttcaagggagataggtttcccggtcgtcctcaag
atagtatcccctcaagtggtccataaaagcgatgtgggcggtgtgaaggtgaacttgagg
agcgaggaggaggtgaggaaggcttacagggagataatcgagaacgtcaagaggaacgtt
ccaaatgctgagatagaaggtatcctagttcaggaattcgcacctccgggtgttgagctg
ataataggtctcctgagggacccgcagttcggacccactgtcatgttcgggctcggaggg
gtcttcgtcgagctcttcagggacgtctcattcagagtcgcccctctatcggagcaggat
gctgaatcaatgataaaggaggtgaaggcatacaagctcctcactggcttcagggggatg
gaaccagtcgatatagaggcgataaaggacgctctgataagggcagggaggataggtgtt
gagaacgaggagatcgctgagatggacctcaacccagtgatagcataccccaaaggtatt
aaagtggttgatgccaggataatcctgaggtga

DBGET integrated database retrieval system