KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0115Help
Entry
Kcr_0115          CDS       T00668                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00010  Glycolysis / Gluconeogenesis
kcr00620  Pyruvate metabolism
kcr00640  Propanoate metabolism
kcr01100  Metabolic pathways
kcr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_0115
   00620 Pyruvate metabolism
    Kcr_0115
   00640 Propanoate metabolism
    Kcr_0115
Enzymes [BR:kcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Kcr_0115
Lipid biosynthesis proteins [BR:kcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kcr_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 RimK ATP-grasp Fer4_NifH CPSase_L_D2 GARS_A DUF1508
Motif
Other DBs
NCBI-ProteinID: ACB06875
JGI: KorOPF10115
UniProt: B1L7P8
Structure
PDB: 

Jmol
Position
complement(118883..119575)
Genome map
AA seq 230 aa AA seqDB search
MSSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLK
IVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVEL
IIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGM
EPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaagggacctattgcttaaagctaaggagaacgggaggaagtccctcctggag
cacgaggccaagtatttcatctccagctatgggattccggtgactaatataagattggcg
aagagtgaggaagaggccgtcaatttttcaagggagataggtttcccggtcgtcctcaag
atagtatcccctcaagtggtccataaaagcgatgtgggcggtgtgaaggtgaacttgagg
agcgaggaggaggtgaggaaggcttacagggagataatcgagaacgtcaagaggaacgtt
ccaaatgctgagatagaaggtatcctagttcaggaattcgcacctccgggtgttgagctg
ataataggtctcctgagggacccgcagttcggacccactgtcatgttcgggctcggaggg
gtcttcgtcgagctcttcagggacgtctcattcagagtcgcccctctatcggagcaggat
gctgaatcaatgataaaggaggtgaaggcatacaagctcctcactggcttcagggggatg
gaaccagtcgatatagaggcgataaaggacgctctgataagggcagggaggataggtgtt
gagaacgaggagatcgctgagatggacctcaacccagtgatagcataccccaaaggtatt
aaagtggttgatgccaggataatcctgaggtga

DBGET integrated database retrieval system