KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0154Help
Entry
Kcr_0154          CDS       T00668                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00240  Pyrimidine metabolism
kcr00250  Alanine, aspartate and glutamate metabolism
kcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Kcr_0154
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kcr_0154
Enzymes [BR:kcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Kcr_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACB06914
JGI: KorOPF10154
UniProt: B1L385
Position
complement(153246..154136)
Genome map
AA seq 296 aa AA seqDB search
MSLRGKDIISISDIKRSDLERIFRVASSRFQGDELKGKIIAMAFFEPSTRTRFSFETATL
RLGGNYIGFEAAQSTSLAKGESFSDTIRMLDSYADGIVVRHSLEGAAKLAAELAEAPVIN
AGDGTKNHPTQAMIDLYTIWKERGNLDNLTYGVLGDLRYGRAAASFLKALNLYSPKKVYL
ICPEGLRPKQELLDSLKMPWEFSDLKDALPELDVLYVTRVQKERFPDPSEYERVKGSYKV
DSSILKDAKEGLMILHPLPRVDEISLDVDSTPYAYYFKQAANGVPVRMALLSEVIP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaggggtaaggatataatctcaatttccgatataaagaggagcgatcttgag
aggatcttcagagtcgcttcatcgaggtttcagggggatgagctcaaggggaagataata
gcgatggccttcttcgaaccgagcaccaggactaggttcagtttcgagacagctaccctg
agactgggtggcaattatataggttttgaagccgcacagtccacatccctggctaaaggt
gagagcttctcagataccataaggatgctggattcttacgctgatggtatagttgtcagg
catagcttggagggggcagctaaactcgcagcagagctagctgaagcccccgttataaat
gcgggggatgggacgaagaaccatcctactcaggctatgatagatctctacacgatatgg
aaggagaggggcaatttggacaacttaacttacggtgtgctgggagatttaaggtatgga
agggctgctgctagctttttaaaagctctcaacctttactccccgaaaaaagtttatcta
atatgtccagaggggctgaggcctaaacaggaacttctggactcccttaagatgccatgg
gagttctcagatctgaaagatgctctacctgagctcgatgtcctatacgtaactagggtc
cagaaggagaggttcccagatccctcggagtacgagagagtcaagggcagctataaggtg
gattcatctatcctcaaggatgctaaggaagggctcatgatactccatcccctcccaagg
gtcgatgagatctccttggacgtggattccactccttacgcttattacttcaagcaagca
gctaacggagttcccgtgaggatggcactattatcggaggtgataccatga

DBGET integrated database retrieval system