KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0354Help
Entry
Kcr_0354          CDS       T00668                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00260  Glycine, serine and threonine metabolism
kcr00750  Vitamin B6 metabolism
kcr01100  Metabolic pathways
kcr01110  Biosynthesis of secondary metabolites
kcr01120  Microbial metabolism in diverse environments
kcr01230  Biosynthesis of amino acids
Module
kcr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kcr_0354
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Kcr_0354
Enzymes [BR:kcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Kcr_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACB07110
JGI: KorOPF10354
UniProt: B1L3T1
Position
364751..365710
Genome map
AA seq 319 aa AA seqDB search
MKMLQQATLLEEFRFPGTLFRVRKIPIAQGWRKIYIKWEGNNPTGTQKDRAAYMHVRRAI
EQGYDTVTVGTCGNFGASLAYFANLHGMRAVIYVPSRYTNGRVREMRKYNAEIVYVDGSY
EDAVERSVLDAMKYGYYDSNPGSVNSRVALESFKAIAYEIVAALGSVPDLVSVPMGNGTT
LAGIYMGFREMLDMGISRKLPVMLGATTGLGNQIAETLKRGSEELVPLREDEVRETEYNE
PLVSIKAFDGEYALEAIRRSGGLAFEFYDEELLQLAEELRMEGIDPLPASSSSLGAIERY
LEFGGYFENAVAVVTGRRF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcttcagcaggcaaccttgcttgaggagttcaggttccccgggactcttttt
agagtgaggaaaatcccgatagctcagggatggaggaagatatacatcaaatgggaggga
aataaccccacggggacccaaaaggacagagcggcttacatgcacgtgaggagggctata
gagcagggatacgatacggtgaccgtgggcacctgcgggaacttcggggcttccttagcc
tacttcgctaacctccacgggatgagggcagtgatatacgtaccgtcacgctacaccaat
gggagggttagggagatgaggaagtacaatgctgagatagtttacgtagatggcagctac
gaggacgctgtggagaggagcgtgctcgatgctatgaaatacggatactacgattccaat
cccgggagcgttaacagtagggtagccctagagtccttcaaggccatcgcttatgagata
gttgcagccctgggctcggtcccagatttagtctccgtcccaatgggaaacggcaccact
ctagctggtatctacatgggcttccgcgagatgctcgatatggggatctcgaggaagctc
ccagtgatgctaggggcaactacgggactggggaatcagatagctgagaccctcaagaga
ggctccgaggagctagtccccctgagggaggatgaagtgagggaaactgagtataatgag
ccattggtctcgataaaggctttcgatggtgagtacgccttggaagctataaggaggagc
ggcggcttagctttcgaattctacgatgaggaactgcttcagctcgctgaggagcttaga
atggaaggtatagaccctcttccagcatcctcctcctctttaggggctatagagagatat
ttagagttcgggggatatttcgagaatgcagtggcagtcgtcacagggagaaggttctga

DBGET integrated database retrieval system