KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0354Help
Entry
Kcr_0354          CDS       T00668                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kcr_0354
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kcr_0354
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Kcr_0354
Enzymes [BR:kcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Kcr_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
364751..365710
Genome map
AA seq 319 aa AA seqDB search
MKMLQQATLLEEFRFPGTLFRVRKIPIAQGWRKIYIKWEGNNPTGTQKDRAAYMHVRRAI
EQGYDTVTVGTCGNFGASLAYFANLHGMRAVIYVPSRYTNGRVREMRKYNAEIVYVDGSY
EDAVERSVLDAMKYGYYDSNPGSVNSRVALESFKAIAYEIVAALGSVPDLVSVPMGNGTT
LAGIYMGFREMLDMGISRKLPVMLGATTGLGNQIAETLKRGSEELVPLREDEVRETEYNE
PLVSIKAFDGEYALEAIRRSGGLAFEFYDEELLQLAEELRMEGIDPLPASSSSLGAIERY
LEFGGYFENAVAVVTGRRF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcttcagcaggcaaccttgcttgaggagttcaggttccccgggactcttttt
agagtgaggaaaatcccgatagctcagggatggaggaagatatacatcaaatgggaggga
aataaccccacggggacccaaaaggacagagcggcttacatgcacgtgaggagggctata
gagcagggatacgatacggtgaccgtgggcacctgcgggaacttcggggcttccttagcc
tacttcgctaacctccacgggatgagggcagtgatatacgtaccgtcacgctacaccaat
gggagggttagggagatgaggaagtacaatgctgagatagtttacgtagatggcagctac
gaggacgctgtggagaggagcgtgctcgatgctatgaaatacggatactacgattccaat
cccgggagcgttaacagtagggtagccctagagtccttcaaggccatcgcttatgagata
gttgcagccctgggctcggtcccagatttagtctccgtcccaatgggaaacggcaccact
ctagctggtatctacatgggcttccgcgagatgctcgatatggggatctcgaggaagctc
ccagtgatgctaggggcaactacgggactggggaatcagatagctgagaccctcaagaga
ggctccgaggagctagtccccctgagggaggatgaagtgagggaaactgagtataatgag
ccattggtctcgataaaggctttcgatggtgagtacgccttggaagctataaggaggagc
ggcggcttagctttcgaattctacgatgaggaactgcttcagctcgctgaggagcttaga
atggaaggtatagaccctcttccagcatcctcctcctctttaggggctatagagagatat
ttagagttcgggggatatttcgagaatgcagtggcagtcgtcacagggagaaggttctga

DBGET integrated database retrieval system