KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0609Help
Entry
Kcr_0609          CDS       T00668                                 

Definition
dual specificity protein phosphatase
Organism
kcr  Candidatus Korarchaeum cryptofilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(622131..622637)
Genome map
AA seq 168 aa AA seqDB search
MKREDIKAIKSMGIKAIVCLATEREVYPFWGGILTYEANVISEGMEFYFLPIEPKGAPDI
RELIDLLTWISSRATRGKPVAIHCFAGVGRAGTVAAAYLIFKGMTPKAAIDQVRRVRPGA
IESSEQEEVLFQLGSVINLVLKKEIPLKLILEPIETKKPRLKIFRLRR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagggaggacataaaggccatcaaatctatggggataaaagctatagtctgcctg
gcgactgagagggaagtatatcctttctggggaggcatactaacttacgaagccaatgtg
atctcagaaggtatggaattctatttcctgcctatagagccaaagggagcccctgacatc
agggaactgatagatttgctgacttggatctcatctagagctactagggggaagcctgta
gctatccactgcttcgccggtgtggggagagcaggtaccgtcgctgctgcttacttgata
ttcaaggggatgacccctaaagccgctatagatcaagtgaggagggtgaggcctggagcg
atagagtctagcgagcaggaggaggtgctcttccaactcggctcggtgataaacttagtt
ttgaagaaggagatacccctgaagctgatattagagcctatagagacgaagaagcccagg
ctgaaaatatttagattgaggaggtag

DBGET integrated database retrieval system