KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0835Help
Entry
Kcr_0835          CDS       T00668                                 

Definition
(GenBank) F420-dependent oxidoreductase
Organism
kcr  Candidatus Korarchaeum cryptofilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
843536..844312
Genome map
AA seq 258 aa AA seqDB search
MELIAIRTRKIVEGDDIVSLLLSLYDPRDLDIVAVADKALAASQGRFVNHDIEPSEEAMK
LAEESGLEPGFAELVIRNSDLVLGTAERTILTVKDGILVANAGIDHKNAPIGFAALWPED
PNYEARRIRDEIAKRTGRNVGVIIVDSRLSPLRMGTTGFALGIAGFRGIRDYRGKSDAYG
KRILVTTLNVADDLASAAHLLMGEGDDLVPFVIIRGAPVEFGDFDPEELKISPDRCAYFR
PIYGRLYEMSGRISGRQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggagctaatagccataaggacccgtaagatagtcgagggagacgatatagtcagcttg
ctcctctccctctacgacccccgggatctggatatagtggctgttgccgataaagctcta
gcagcaagccaggggaggttcgttaatcacgacatagagccatctgaggaagccatgaag
ttagctgaggaatcaggtttggagcccggtttcgccgagctagtcataaggaactccgat
ctagttttggggactgccgagaggactatattgactgttaaagatggtatattagttgct
aatgcggggatagatcataagaacgctcctataggtttcgcagccctatggccggaggac
ccgaactatgaggctaggaggataagggatgagatagctaagaggactgggaggaatgta
ggagttataatagtagatagcaggctctcaccactcaggatggggactactggattcgct
ctagggatagctggcttcagggggataagggattacagggggaagagcgacgcttacggg
aagaggatattggtgaccactctcaacgtggccgatgatctggcatcggcagcgcatctc
ctcatgggtgagggggatgatctggtccccttcgtgataataaggggcgctcccgttgag
ttcggggatttcgatccagaggagcttaagataagcccagatagatgcgcttacttcagg
ccgatttacggtcgcttgtatgaaatgtctggaagaatatcgggtcggcagaagtag

DBGET integrated database retrieval system