KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0883Help
Entry
Kcr_0883          CDS       T00668                                 

Definition
(GenBank) peptidase M42 family protein
Organism
kcr  Candidatus Korarchaeum cryptofilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(889144..890157)
Genome map
AA seq 337 aa AA seqDB search
MDLKLLERLSLASAPPGFEDEVREILKEELEGRVDELQEDGFGNLYAVKGSGRKVMFAAH
MDEVAMMVRHIDERGFLRVVALGGLSPSQLVAQRVVVHGKVKLRGIVGTLPAHMGEEKIP
KMDELYVDVGASSGEEARSLGIRPGTLITFDSPFIYQPETGSLIGKALDDRLGCFLLAEA
LKSVEPGEKIYAVFTCEEERGLRGAQVAANRVRPDLAFVLEGTIASDVPEVQEYNYITQL
GKGPAIRVMDRGLIVKGWLLESIIARAEGLGIPYQLQLSPVSSTDAAPISLSGDGVAVGV
ISVPARYIHSPQALAKVSDIENSLKLVKSLMEDPPRK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatttgaagctcctggagaggctttccctagcatctgctccgccgggttttgaggat
gaggtcagggagatcttgaaggaggagctagagggcagagtagatgagctccaagaggac
gggttcgggaacttatacgctgtgaaggggagcgggaggaaagtgatgttcgcggctcac
atggatgaagtggccatgatggtgaggcatatagatgagaggggcttcctcagagtagta
gcccttggaggcctcagcccatcgcaattagtcgctcagagggtagttgttcacgggaaa
gtgaagctcaggggaatagtgggcactcttccagctcacatgggtgaggagaagatccct
aagatggatgagctttacgtggatgtgggtgcttccagcggagaggaggctaggagcctc
gggataaggccgggcactctaataaccttcgattctccgttcatatatcaacccgagaca
gggtctttaattgggaaggcattggacgatagattaggatgcttcctgctcgctgaggca
ttgaagagcgtggaacctggtgaaaaaatatatgctgttttcacttgcgaggaggagagg
gggctcaggggcgcccaagtagcggccaatagagtgaggccagaccttgccttcgtcttg
gagggtactatagcatcggatgtacccgaggtccaggagtacaactatataactcaactg
gggaaggggccggcgataagggtgatggataggggattgatagtcaagggatggctactg
gaatcgattatagctagagctgaaggattagggatcccctaccagctccagctatccccg
gtgagcagcacggatgctgcgcctataagcttgagcggggatggggtagctgtaggagtg
atctcagtcccggccaggtatatacattcgcctcaagccctagctaaagtcagcgatata
gagaactctctgaagctagtcaagagcctcatggaggatcccccgaggaagtga

DBGET integrated database retrieval system