KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1137Help
Entry
Kcr_1137          CDS       T00668                                 

Definition
Histones H3 and H4
Organism
kcr  Candidatus Korarchaeum cryptofilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1145322..1145546
Genome map
AA seq 74 aa AA seqDB search
MPRVRYLPLAPIGRIIRDAGAERVSDAAVEALERYMEKFALEVGRQAVSLAKHANRKTVS
GEDIDLAIKTVWKA
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccaagggttaggtatctgcctctcgctcccattgggaggataataagagacgctggt
gcggagagggtaagtgacgcagccgttgaggcattagagcgctatatggagaagtttgcg
ctcgaagtgggcaggcaggctgtcagtctggccaaacacgcgaacaggaagactgtatcc
ggtgaggatatagatctcgcgataaagaccgtttggaaggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system