KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1208Help
Entry
Kcr_1208          CDS       T00668                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kcr_1208
Enzymes [BR:kcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Kcr_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1216684..1217589)
Genome map
AA seq 301 aa AA seqDB search
MKFVAIGNANVDIKVFLEAIPGQDESIDALAITMSSGGAASNFAMAAAKIGIESYIIASL
GNDELGKFYLESLRRANVNTSYIKIAEGVRTGLVLILNVLGEDRRMIQSSGANEELSPSD
ILERRELISSADEVHMATVRPEIAESVLEIREASWDPGMRMILKYKRKIWPLLGKAGKIF
LNEKEAQELSGERDPVDCAIKIAKEGTKEIVIKMGSKGSLAYVDGETHRVDAIPVKVVDT
TGAGDIFAAVYLKARRRGFSIDDCLKLANAASTIKVSRPSGVDSLPTWDEIQTMKLIFYG
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtagctataggcaatgcgaatgtcgacataaaggtattcttagaggccata
cctggacaggatgaatcaatagatgctctagctatcactatgagttctggaggggcggcc
tccaacttcgctatggcagcagctaagatcggcatcgagtcctacataatcgcgtcgctt
gggaatgatgaactcggtaaattttacttggagtcattgaggagagcaaatgtgaacaca
tcttacataaaaatagccgaaggcgttaggacaggcctcgtcctcatactgaacgttcta
ggtgaggataggaggatgatacagagctcaggagcaaatgaggagctatctccctcagat
atcttggagaggagggaactcatatcctcagctgatgaagtccacatggcgactgtgagg
cccgagatagcggaatccgtcttagagataagggaggcctcttgggaccccgggatgagg
atgatattgaagtacaagcgtaagatttggccgctcctcggaaaggctggaaaaattttc
ctgaacgagaaagaggctcaagagctatcaggggagagagatcctgtagattgtgctatc
aaaatagctaaagaaggaactaaggaaatagtgataaaaatgggatccaagggctcccta
gcttatgtagatggcgagactcatcgcgtcgatgcaattccagtcaaagtggtcgatact
actggggctggcgatatattcgcagccgtatatctcaaggccaggaggagaggattctcg
atagatgattgcttgaagctcgctaacgccgcatcaacgataaaggtctcgaggccaagt
ggcgtagatagcctgccgacttgggatgagatacagacgatgaaactaatattctacggg
aaatga

DBGET integrated database retrieval system