KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1228Help
Entry
Kcr_1228          CDS       T00668                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kcr_1228
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_1228
   00020 Citrate cycle (TCA cycle)
    Kcr_1228
   00620 Pyruvate metabolism
    Kcr_1228
   00640 Propanoate metabolism
    Kcr_1228
   00650 Butanoate metabolism
    Kcr_1228
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Kcr_1228
   00680 Methane metabolism
    Kcr_1228
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Kcr_1228
Enzymes [BR:kcr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Kcr_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1232794..1233999
Genome map
AA seq 401 aa AA seqDB search
MALNGDEAVAWAVKQSNVDVVSAYPITPQTIIVERISEFVNDGEMDAEFIHVESEHSALS
AAWGAALAGARAFTATAANGLALMWEILYITASTRAPVVMAVVNRALSAPINIHNDHSDT
MGARDSGWIQIYSEDAQEAYDNTIMAFKIAEQALFPVMVTLDGFTISHTLQNVIVLPDDV
VSDFVGVRKIPRIKLPRIHGEKEIPLMLNPKYPITFGPLDLYDYYFEHKVQQNEAMKETF
PIIERVHKEYGEISGRSYEPVFMIPYRTDDADVVIFGLSSTMSVVRKVVDELRAEGKKVG
AIRLRVFRPFPANIIRKELSKFHAVGILDRCISFGGEGGPLFTEVRSALYRSSSRPIVHD
YIYGLGGRDLPRKLIVKIFEELLSAREEPESPVVRYVGVRE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccctaaacggtgatgaagcggttgcttgggccgtgaaacagagcaatgttgatgta
gtttcagcttatccaataactcctcagacaataatagttgagagaatatctgaattcgtc
aacgacggcgagatggatgctgagttcatacacgtggagagcgagcatagtgcattaagt
gccgcatggggagcggctttagctggcgctagagcattcacagcaactgcagcgaacggt
ttagcactaatgtgggaaattttgtatattacggcatcgactagagcccctgttgtgatg
gctgtcgtaaatagggctttgagcgctccaataaacatacataatgatcacagcgatacg
atgggagctagggactcgggctggatacagatatacagtgaagatgcccaagaggcatat
gataacacaataatggcctttaaaattgcagagcaagcgctattccctgtgatggtaacc
ttagatggatttacaatctctcatacactccagaatgtcatagtgctccctgatgatgtt
gtttcggatttcgtcggtgtcaggaagatccctaggataaagctgcctaggattcatggc
gagaaggagataccactgatgctcaaccccaagtacccgataacattcggtccacttgat
ctctatgactattacttcgagcacaaagtccagcagaacgaggctatgaaggagactttc
ccgataatagagagggtccataaggagtatggagagatcagcggaagatcttatgagccc
gtcttcatgatcccatataggacggatgatgccgatgtcgtgatcttcgggctctcctca
acgatgagtgtggtgaggaaagtggtggatgagctcagggctgaagggaagaaagttgga
gcgattaggctcagagtattcagaccgttcccagccaatataattaggaaggagctctca
aagttccatgcggtcggcatcctagatagatgcataagcttcggaggggagggaggtcca
cttttcacggaggtaagatctgccctctatagatcgagttccagacccatagtacatgat
tacatatatggattgggaggaagagatcttccacgcaagcttatagttaaaatctttgaa
gaacttctctccgctagggaggagccggagtcgcctgtagtgaggtacgtgggggtgagg
gagtga

DBGET integrated database retrieval system