KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1248Help
Entry
Kcr_1248          CDS       T00668                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kcr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kcr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:kcr03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:kcr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kcr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1249730..1250410)
Genome map
AA seq 226 aa AA seqDB search
MSSVLKDLAERQLHLMILGDWKRVDPKLLEYLEGELGTEPEKDPIGVAFCLLRIGVSPEK
ATSLLSWKDFETFCMRGLQIHGMEAIRGLRFKNDRRYEIDVLGIGEGLILLIDCKMWSTK
GRSGKIESVARDHLRKAKAFDEAIRFDSIDGLIRGTGKSQIIPVIVSWLDTGVVRSKDGV
AIVSLRNFPSFLNSIDELEDFLKIDVDYRIKIRRETPSRNLSVLRF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagtgctcaaggacctcgctgagaggcagctccacctaatgatcttgggagat
tggaaaagagttgatccgaaactcttagaatacttagagggcgaactggggacagaaccg
gagaaggatccaataggagttgccttttgcctcctgaggataggagtttccccggagaag
gccacttctctattgagctggaaggacttcgagactttctgcatgagggggcttcagata
catggaatggaggctattaggggattaaggttcaagaatgataggagatatgagatagat
gtcctaggtataggtgagggactcatcctacttatagactgtaagatgtggtccacgaag
gggagatctgggaagatagaatccgtagctagggatcatttgagaaaagctaaagctttt
gatgaagctatcagattcgactcaatagatggtttgattagggggaccggaaaatctcaa
ataattccagttatagtttcctggctcgatacaggggttgttagatccaaagacggtgta
gctatagtgagtctaaggaatttcccaagtttcctgaactccatcgacgaactggaagat
ttcttgaaaatagatgttgattatagaattaagatacggagagaaactccctcaaggaat
ctatcagttctgagattttga

DBGET integrated database retrieval system