KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1248Help
Entry
Kcr_1248          CDS       T00668                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Kcr_1248
   00240 Pyrimidine metabolism
    Kcr_1248
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Kcr_1248
   03430 Mismatch repair
    Kcr_1248
   03440 Homologous recombination
    Kcr_1248
Enzymes [BR:kcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Kcr_1248
DNA replication proteins [BR:kcr03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Kcr_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1249730..1250410)
Genome map
AA seq 226 aa AA seqDB search
MSSVLKDLAERQLHLMILGDWKRVDPKLLEYLEGELGTEPEKDPIGVAFCLLRIGVSPEK
ATSLLSWKDFETFCMRGLQIHGMEAIRGLRFKNDRRYEIDVLGIGEGLILLIDCKMWSTK
GRSGKIESVARDHLRKAKAFDEAIRFDSIDGLIRGTGKSQIIPVIVSWLDTGVVRSKDGV
AIVSLRNFPSFLNSIDELEDFLKIDVDYRIKIRRETPSRNLSVLRF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagtgctcaaggacctcgctgagaggcagctccacctaatgatcttgggagat
tggaaaagagttgatccgaaactcttagaatacttagagggcgaactggggacagaaccg
gagaaggatccaataggagttgccttttgcctcctgaggataggagtttccccggagaag
gccacttctctattgagctggaaggacttcgagactttctgcatgagggggcttcagata
catggaatggaggctattaggggattaaggttcaagaatgataggagatatgagatagat
gtcctaggtataggtgagggactcatcctacttatagactgtaagatgtggtccacgaag
gggagatctgggaagatagaatccgtagctagggatcatttgagaaaagctaaagctttt
gatgaagctatcagattcgactcaatagatggtttgattagggggaccggaaaatctcaa
ataattccagttatagtttcctggctcgatacaggggttgttagatccaaagacggtgta
gctatagtgagtctaaggaatttcccaagtttcctgaactccatcgacgaactggaagat
ttcttgaaaatagatgttgattatagaattaagatacggagagaaactccctcaaggaat
ctatcagttctgagattttga

DBGET integrated database retrieval system