KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1249Help
Entry
Kcr_1249          CDS       T00668                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kcr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:kcr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:kcr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1250663..1251946
Genome map
AA seq 427 aa AA seqDB search
MLRMDLKGEDLPKYWYNIVSDLPDLPPPIHPATKEPLGPNDFYPLFPKECVNQEFSKERY
VAIPEELREFYLRIGRPTPLYRAKRLEEYLGTPAKIYYKREDVSPTGSHKLNTALAQAFY
AAKEGLEYLTTETGAGQWGSALSYATMMMGIRALVFMVRISYLQKPYRKLVMRLYGAEVV
PSPSDRTEVGRKYLERDPEHPGSLGIAISEAIEAAMKDDKAKYSLGSVLNHVLLHQTIIG
LEAKKQFEALGEKPDILIGCVGGGSNFAGFTFPFLEEVLKEKGSYDVVAVEPSAVPSLTD
GEYRYDFGDTAGITPLLMMYTLGHDFVPPPIHAGGLRYHGAAPTVSLLKKKGIIRSVKYP
QEDVFEAGRIFARTEGIIPAPETNHAIKAAIDEALKAKKDGERKIIAFNFSGHGLLDLKG
YEDVLKI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaatggaccttaagggagaggatctgccgaagtactggtacaatatagtctcc
gacctccctgacctacctcctcccatacatccagccacgaaggagcctctcgggcccaat
gacttctacccacttttccccaaggagtgcgtgaatcaggagttctccaaggagaggtat
gtagctatacccgaggagctgagggaattctatctcaggatagggaggcccactcctctc
tatagagctaagaggctcgaagaatatttggggactccggctaaaatatactataagagg
gaggacgtatcgccaacaggaagtcacaagctgaacactgcattagctcaagccttctat
gctgcgaaggaggggctggaataccttacaactgagaccggggctgggcagtggggcagc
gccttatcttatgcgacgatgatgatgggaataagagccctcgtcttcatggtcaggata
tcctatctccagaagccttacaggaagctcgtcatgaggctctacggcgccgaggtagtt
ccttccccgagcgataggaccgaggtcgggaggaagtacctagagagggatcccgagcac
cctggatcattggggatagctataagtgaagctatagaagctgctatgaaggatgataag
gctaagtattccctagggagcgtcctcaatcacgtactcctccatcagacgataatagga
ttggaagctaagaagcagttcgaggcattgggggagaagcccgatatcttgatagggtgc
gtcggcggggggagcaacttcgcgggcttcaccttcccgttcttggaggaagtcctgaag
gagaagggaagttatgatgtagtggctgtagagccatcagcagttccctcactgaccgat
ggagaatatagatatgatttcggtgatacagctggtataactcccctgctgatgatgtat
acgttaggccacgacttcgtaccacctcctattcacgctggcggtttgaggtatcacggc
gctgcgcctacagtgagcttactgaagaagaaaggtataataaggtcggtcaagtacccg
caggaggatgtgttcgaagcgggcaggatcttcgcaaggacggaggggataatcccagcg
ccagagacgaatcatgcgataaaagccgcaatagatgaggctttgaaggctaaaaaggac
ggtgagaggaagataattgcctttaacttctccgggcatgggctgctggatctgaaaggt
tatgaagatgttttgaaaatttaa

DBGET integrated database retrieval system