KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1249Help
Entry
Kcr_1249          CDS       T00668                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kcr_1249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kcr_1249
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kcr_1249
Enzymes [BR:kcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kcr_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1250663..1251946
Genome map
AA seq 427 aa AA seqDB search
MLRMDLKGEDLPKYWYNIVSDLPDLPPPIHPATKEPLGPNDFYPLFPKECVNQEFSKERY
VAIPEELREFYLRIGRPTPLYRAKRLEEYLGTPAKIYYKREDVSPTGSHKLNTALAQAFY
AAKEGLEYLTTETGAGQWGSALSYATMMMGIRALVFMVRISYLQKPYRKLVMRLYGAEVV
PSPSDRTEVGRKYLERDPEHPGSLGIAISEAIEAAMKDDKAKYSLGSVLNHVLLHQTIIG
LEAKKQFEALGEKPDILIGCVGGGSNFAGFTFPFLEEVLKEKGSYDVVAVEPSAVPSLTD
GEYRYDFGDTAGITPLLMMYTLGHDFVPPPIHAGGLRYHGAAPTVSLLKKKGIIRSVKYP
QEDVFEAGRIFARTEGIIPAPETNHAIKAAIDEALKAKKDGERKIIAFNFSGHGLLDLKG
YEDVLKI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaatggaccttaagggagaggatctgccgaagtactggtacaatatagtctcc
gacctccctgacctacctcctcccatacatccagccacgaaggagcctctcgggcccaat
gacttctacccacttttccccaaggagtgcgtgaatcaggagttctccaaggagaggtat
gtagctatacccgaggagctgagggaattctatctcaggatagggaggcccactcctctc
tatagagctaagaggctcgaagaatatttggggactccggctaaaatatactataagagg
gaggacgtatcgccaacaggaagtcacaagctgaacactgcattagctcaagccttctat
gctgcgaaggaggggctggaataccttacaactgagaccggggctgggcagtggggcagc
gccttatcttatgcgacgatgatgatgggaataagagccctcgtcttcatggtcaggata
tcctatctccagaagccttacaggaagctcgtcatgaggctctacggcgccgaggtagtt
ccttccccgagcgataggaccgaggtcgggaggaagtacctagagagggatcccgagcac
cctggatcattggggatagctataagtgaagctatagaagctgctatgaaggatgataag
gctaagtattccctagggagcgtcctcaatcacgtactcctccatcagacgataatagga
ttggaagctaagaagcagttcgaggcattgggggagaagcccgatatcttgatagggtgc
gtcggcggggggagcaacttcgcgggcttcaccttcccgttcttggaggaagtcctgaag
gagaagggaagttatgatgtagtggctgtagagccatcagcagttccctcactgaccgat
ggagaatatagatatgatttcggtgatacagctggtataactcccctgctgatgatgtat
acgttaggccacgacttcgtaccacctcctattcacgctggcggtttgaggtatcacggc
gctgcgcctacagtgagcttactgaagaagaaaggtataataaggtcggtcaagtacccg
caggaggatgtgttcgaagcgggcaggatcttcgcaaggacggaggggataatcccagcg
ccagagacgaatcatgcgataaaagccgcaatagatgaggctttgaaggctaaaaaggac
ggtgagaggaagataattgcctttaacttctccgggcatgggctgctggatctgaaaggt
tatgaagatgttttgaaaatttaa

DBGET integrated database retrieval system