KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1267Help
Entry
Kcr_1267          CDS       T00668                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Kcr_1267
Enzymes [BR:kcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Kcr_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1266912..1267508
Genome map
AA seq 198 aa AA seqDB search
MEDIDLLAGELAEVMRIAYIKGITTGGGGNASIRISDGFLITPSGKFKGRLEGKDILMIN
NRGEVIRGTGKPSSEWRLHLKIYSMREDINSVLHCHHPLATAFSISFRDSLKDIVRDFMT
EEASIFLKELTVVPWRPFGTQELADIVSEALKDSNAVLIERHGALVVAEDHWKALAAMES
LLETLWIFLFCKILRGIT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggaggacatagatttactggccggtgagttagctgaagtcatgaggatagcctacatt
aaggggatcactactggaggagggggaaacgcgagcataaggatctctgacgggttcctc
ataaccccctctgggaaattcaaggggagactcgagggaaaggatatcctcatgataaac
aataggggcgaggttattcgagggacaggtaaacctagctccgaatggaggttgcacttg
aagatatattctatgagggaagatatcaactccgtcctgcactgccatcatcctctagcc
acagcattctcgatctccttcagggactccttgaaagatatcgttagagatttcatgacg
gaggaagcgagcatcttcctgaaggagctgactgtagttccatggagaccattcgggact
caggaactagctgatatagttagtgaagcattgaaagattccaatgcagtcttaatagag
agacacggggcattagttgtagctgaggatcactggaaagccctcgctgctatggaatct
cttttggagacgctatggatcttcttattctgtaagatcttgagggggattacctga

DBGET integrated database retrieval system