KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1289Help
Entry
Kcr_1289          CDS       T00668                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Kcr_1289
Enzymes [BR:kcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Kcr_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1287335..1288189)
Genome map
AA seq 284 aa AA seqDB search
MRDPYEESKYVVVAVPYDSTESWARGTRFGPMAIIEASRYMDPYDIELRAFVNDMGIHTI
FELPVLGKSVSSMMDIVETTVRRLRGDGKIPILLGGEHTISFPALRALNHEIDAIVVLDA
HPDFYDEYEGNKISHATVCKRMSELVGDIILIGVRAMDFDEGKNLDKIGSVNIIFSERME
ENLEILNGIRGKRVYLSVDVDVLDPPQVPCVGNPEPGGLSYGQVLKIIKKVVELSDVRCM
DFVEFAPCPGVRSDAFLVARLVQKAIGYHAFYSGNDKLRDRSYE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgagggacccatacgaggagtccaaatatgttgtagtggccgtaccttatgactcaacg
gagagctgggctagaggaactaggttcgggcccatggcgataattgaggcatctaggtac
atggatccatacgacatagagctcagagcgttcgtgaatgatatgggaattcatacaatt
tttgagctccccgtccttgggaagtcagttagctcaatgatggatatcgtagaaactact
gttagaagattgaggggagatgggaagataccgatacttctaggcggggagcacacgata
tcatttccagccttgagggcgttaaatcacgaaatcgatgctatcgtagtattagacgcg
catcccgatttctatgatgaatacgagggaaataagatctcacacgccacggtgtgcaag
aggatgagcgagctcgtgggggatataatcctgataggagtgagggcgatggacttcgat
gaaggtaaaaaccttgataaaatcggctctgttaatataatattttcagagagaatggag
gaaaatttggagatcttaaatggaataaggggaaaaagagtctacttgagcgtcgatgtg
gatgtattggatcctccccaagtaccctgcgtcgggaacccggaaccaggggggcttagc
tacggacaggtcctgaagataataaagaaagtagtagagctcagcgatgtgagatgcatg
gatttcgttgaatttgctccatgtccaggggtcagatcggacgccttcctagtggccagg
cttgtccagaaggccatagggtatcatgccttttactctgggaatgataagctccgagat
cgctcctatgaataa

DBGET integrated database retrieval system