KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1292Help
Entry
Kcr_1292          CDS       T00668                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit alpha
Organism
kcr  Candidatus Korarchaeum cryptofilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1289060..1290286
Genome map
AA seq 408 aa AA seqDB search
MVEGEWNIITGNHAAALAAKLARVNVVAAYPITPQTTVVEYLASFIESGYMNAEYIRVES
EHSAMAAVIGAAAAGARTFTATSSQGLVYMSEVLHWAAGSRTPIGMAVINRALGPPWNIH
VDHQDSMSQRDTGWMQIYVSSNQEVLDTILMMYKVAEHPDVMLPFMVCLDAFVLSHTFMP
VNVPRQEDVDEFLPPFRPAWILDPSDPISFGSLVLPDEEYQEMRWSMDLSMRRALEVMED
VAEEFNEKFGRYHGAAVMKYKMNDADYVILTSATLASEAEVAVDIMRDEGISVGLLKLRS
FRPFPHRDIKENLQGKKGVVVIDRSISFSSGGPIGTEVRSSLYDLSGAPPVVNYISGLGG
RDLTYKDVIAMFKDAVSRIASGRVRKPYYWYKLKPEYQRIELAEEVVI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaggtgagtggaatataataactgggaaccatgccgcagctctcgcagcaaaa
cttgctagggtcaatgtagttgccgcatatccgataactcctcagacaacagtcgtcgag
tatctagcttctttcatagaatccggttatatgaacgctgaatacataagggtcgagagt
gagcacagtgcgatggcagccgtcataggagctgcggccgcaggcgctaggactttcacg
gccacatcaagccaggggctcgtctacatgtcggaggtacttcactgggccgcgggttcc
aggacgccgattggcatggctgtgataaacagagctttaggacctccttggaacatccat
gtggaccatcaggactcaatgtcccagagggatacgggatggatgcagatatatgtttcc
tcgaatcaagaggttctagatactatattaatgatgtacaaagtggcagagcatcccgat
gtgatgctccccttcatggtatgcttggacgccttcgtcctaagtcacactttcatgcca
gttaatgtgccaaggcaggaggatgtcgatgagttccttccacctttcagaccggcttgg
attctagatccatccgatcctataagttttggaagcctagttctcccggatgaggaatat
caagagatgaggtggtccatggatctctcaatgagaagggcactcgaagtgatggaggac
gtagctgaggaattcaatgagaagtttggaaggtaccatggagctgctgtcatgaagtac
aagatgaacgatgccgactatgtgatattgacatcggcaacgctagcctctgaggcggaa
gttgctgtagatatcatgagagatgaggggataagcgtaggccttctgaagcttaggtcg
ttcaggccattcccgcaccgcgatatcaaggagaacctgcagggtaagaagggagtggta
gttattgataggagcatatccttcagttcgggtggacccattgggactgaagtgagatcc
tctctctacgatttgagcggggctcctccggtagtgaattatataagcggccttggaggc
agggatctcacttacaaagatgtgatcgcgatgttcaaggatgcagtcagtaggatagct
tctggtagagtgaggaagccgtattactggtacaaattgaagccggagtatcagaggatt
gagctagctgaggaggtggtgatatga

DBGET integrated database retrieval system