KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1292Help
Entry
Kcr_1292          CDS       T00668                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit alpha
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kcr_1292
Enzymes [BR:kcr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Kcr_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1289060..1290286
Genome map
AA seq 408 aa AA seqDB search
MVEGEWNIITGNHAAALAAKLARVNVVAAYPITPQTTVVEYLASFIESGYMNAEYIRVES
EHSAMAAVIGAAAAGARTFTATSSQGLVYMSEVLHWAAGSRTPIGMAVINRALGPPWNIH
VDHQDSMSQRDTGWMQIYVSSNQEVLDTILMMYKVAEHPDVMLPFMVCLDAFVLSHTFMP
VNVPRQEDVDEFLPPFRPAWILDPSDPISFGSLVLPDEEYQEMRWSMDLSMRRALEVMED
VAEEFNEKFGRYHGAAVMKYKMNDADYVILTSATLASEAEVAVDIMRDEGISVGLLKLRS
FRPFPHRDIKENLQGKKGVVVIDRSISFSSGGPIGTEVRSSLYDLSGAPPVVNYISGLGG
RDLTYKDVIAMFKDAVSRIASGRVRKPYYWYKLKPEYQRIELAEEVVI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaggtgagtggaatataataactgggaaccatgccgcagctctcgcagcaaaa
cttgctagggtcaatgtagttgccgcatatccgataactcctcagacaacagtcgtcgag
tatctagcttctttcatagaatccggttatatgaacgctgaatacataagggtcgagagt
gagcacagtgcgatggcagccgtcataggagctgcggccgcaggcgctaggactttcacg
gccacatcaagccaggggctcgtctacatgtcggaggtacttcactgggccgcgggttcc
aggacgccgattggcatggctgtgataaacagagctttaggacctccttggaacatccat
gtggaccatcaggactcaatgtcccagagggatacgggatggatgcagatatatgtttcc
tcgaatcaagaggttctagatactatattaatgatgtacaaagtggcagagcatcccgat
gtgatgctccccttcatggtatgcttggacgccttcgtcctaagtcacactttcatgcca
gttaatgtgccaaggcaggaggatgtcgatgagttccttccacctttcagaccggcttgg
attctagatccatccgatcctataagttttggaagcctagttctcccggatgaggaatat
caagagatgaggtggtccatggatctctcaatgagaagggcactcgaagtgatggaggac
gtagctgaggaattcaatgagaagtttggaaggtaccatggagctgctgtcatgaagtac
aagatgaacgatgccgactatgtgatattgacatcggcaacgctagcctctgaggcggaa
gttgctgtagatatcatgagagatgaggggataagcgtaggccttctgaagcttaggtcg
ttcaggccattcccgcaccgcgatatcaaggagaacctgcagggtaagaagggagtggta
gttattgataggagcatatccttcagttcgggtggacccattgggactgaagtgagatcc
tctctctacgatttgagcggggctcctccggtagtgaattatataagcggccttggaggc
agggatctcacttacaaagatgtgatcgcgatgttcaaggatgcagtcagtaggatagct
tctggtagagtgaggaagccgtattactggtacaaattgaagccggagtatcagaggatt
gagctagctgaggaggtggtgatatga

DBGET integrated database retrieval system