KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1392Help
Entry
Kcr_1392          CDS       T00668                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00020  Citrate cycle (TCA cycle)
kcr00640  Propanoate metabolism
kcr00660  C5-Branched dibasic acid metabolism
kcr00720  Carbon fixation pathways in prokaryotes
kcr01100  Metabolic pathways
kcr01110  Biosynthesis of secondary metabolites
kcr01120  Microbial metabolism in diverse environments
kcr01130  Biosynthesis of antibiotics
kcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kcr_1392
   00640 Propanoate metabolism
    Kcr_1392
   00660 C5-Branched dibasic acid metabolism
    Kcr_1392
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Kcr_1392
Enzymes [BR:kcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Kcr_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA ATP-grasp GARS_A MutL
Motif
Other DBs
NCBI-ProteinID: ACB08138
JGI: KorOPF11392
UniProt: B1L6Q9
Position
complement(1388470..1389606)
Genome map
AA seq 378 aa AA seqDB search
MRLLEYESKEALASKGIPIPKGILARDPEEAASAVEKLGGRGVLKIQIPHGQRGKAGGIK
LVNSPNEAREVAKELFSRTFYGYEVSSLLVEEPVDTATEIYIGGIIDRNSRGMTFISTPY
GGMDVEEIAASHPESIEKRTVHPLMGMRSHIARALAKNAAKNVPDKVNEIQRIISSLWDV
AVEYDAVMLEINPLALTKDGRLVALDARIEVDDNALFRHMEFEKRYYSSENPRENEARKR
DIAYVELDGNIGTMANGAGLAMATMDLVHTFGGKPANFCDVGGGASADRVANALEIILSN
PRASVVLINTLCGITSALDVALGVKSIKEKGLLKIPVVVRMSGNQADEGKRILEEIGIKA
TESAEEAVRYAVELAKRA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttctggagtatgagtcaaaggaggccctggcctctaagggtataccgattccg
aagggaattctagcgagagatcctgaggaagctgcttcagctgttgagaaacttggagga
agaggggttctgaagatacagataccacatggacagagagggaaagctggcgggataaag
ttagtcaattctccaaatgaagcgagagaggtggctaaagagctattttcaaggactttc
tatggatatgaagtgagctccttgctcgttgaggagcccgttgatactgccactgagata
tatatcggagggataattgacaggaattcgaggggcatgaccttcatatccaccccttac
ggagggatggatgttgaggagatagctgcaagccaccccgagtcgatagagaagaggact
gtccacccgctcatggggatgaggtcccatatagctagggctctagctaaaaacgcagcc
aagaatgtcccagataaggttaacgagatacagaggataataagttcattgtgggatgtg
gcggtcgaatatgatgcggtgatgctcgagataaaccccctagccctgaccaaggatggg
aggctcgtagcactggatgctaggatagaggttgatgataacgctctcttcaggcacatg
gaattcgagaagaggtattactcatcggagaatccgagggagaatgaagcgaggaagagg
gatatagcttacgtagagctggacggtaacatagggaccatggctaatggggccggttta
gccatggccactatggatctggtccacactttcggcggtaagccagctaatttctgcgat
gtcgggggaggggcctcagcggacagagtagctaacgccttggagataatactctcgaac
cccagggccagcgtcgtcctcataaatactttatgcggtatcacgagcgcattagacgtc
gcactcggagttaaatctattaaggagaagggattgctcaagatcccggtagtggtcagg
atgagcgggaatcaggctgatgaggggaagaggatactcgaggagatagggataaaggct
acggagtccgctgaggaggcagtgaggtacgctgtggagctcgctaagcgagcgtaa

DBGET integrated database retrieval system