KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1422Help
Entry
Kcr_1422          CDS       T00668                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Brite
Enzymes [BR:kcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Kcr_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_3 GCD14 Methyltransf_24 Met_10 DUF938 Methyltransf_11 TrmK RrnaAD Ubie_methyltran Methyltransf_18 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ACB08168
JGI: KorOPF11422
UniProt: B1L6T9
Position
complement(1411262..1411927)
Genome map
AA seq 221 aa AA seqDB search
MDHARLIESLVRRGIIKTEKVRRAAERVKRELFVPERYKEVAYEDIPLPIGDDQTISAPH
MVFIMNEVLDLEEGQLVLEVGSGSGYHAATIAEIVAPSDSPPSRWGAVITVEINPRLASL
AFENLSKAGYSSRVHVVNADGSSGLPLRRKVDRIVVTAAAPQIPPPLIEMLADGGKLVIP
VGSPGFWGQDLLLVEKRGNNIIKKHITEVAFVPLRGRYGWS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctagactcatcgagagcttggttaggagaggtataataaaaacggagaag
gtgaggagagctgccgagagggttaagagggagctcttcgtccctgagagatataaggag
gtagcttatgaggacatacccttaccgataggggatgatcagacgataagcgcccctcac
atggtcttcattatgaacgaagtgctcgatctcgaggaggggcagttggtcctcgaagtt
ggatcgggcagcggttaccatgctgctactatagccgagatagttgcccccagcgattca
ccaccatcgagatggggggcagtcataacggtggagataaatcccaggctagcctcacta
gctttcgagaacctgagtaaagcgggctattcctcgagagttcacgtagtgaatgctgat
ggaagctctggattgcccctcaggagaaaggtggataggatagttgtcacggcagcggca
ccccagatacctcccccactcatcgagatgctagctgatggcgggaagctagtcataccc
gtgggaagtccgggtttctggggtcaggacctcctgttagttgagaagaggggcaataat
atcattaagaagcatataactgaggtagctttcgtccctctgaggggtagatacggatgg
agctga

DBGET integrated database retrieval system