KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1467Help
Entry
Kcr_1467          CDS       T00668                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kcr_1467
   01230 Biosynthesis of amino acids
    Kcr_1467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_1467
   00030 Pentose phosphate pathway
    Kcr_1467
   00051 Fructose and mannose metabolism
    Kcr_1467
  Energy metabolism
   00680 Methane metabolism
    Kcr_1467
Enzymes [BR:kcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Kcr_1467
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Kcr_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1449987..1451084
Genome map
AA seq 365 aa AA seqDB search
MVRTTVSVIKADIGGLAGHHIVHPKLKEIAASELAEAKSSRIIEDFYITSVGDDLQLIMT
HRKGVDSSEVHGLAWNTFKKCADAAKELGLYGAGQDLLKDAFSGNLRGMGPGVAEMEFEE
RPSDPIVVFMADKTEPGAFNLPIFKIFADPFNTAGLVIDPKLHSGFIFEIMDVIESKVVE
LSSPEDMYDILSIIGTPSRYVIKRVFRKVDREIAASISTTRLSLIAGKYVGKDDPVAIVR
AQAGFPALGEILEPFSFPFLVAGWMRGSHAGPLMPVSERDARPTRFDGPPRIVALGFQVK
DSKLIGPSDLFSDVAFDETRRMANFIADYMRRHGPFMPHRLGPEEMEYTTLPEVLKKLEG
KFRHE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtcagaacgacggtctcagttataaaagcggatatcgggggcctcgcgggccatcat
atcgttcatcctaagctcaaggagatagctgcgagcgaactagctgaagcaaaatcctcc
agaatcatagaggatttctacattacctcagttggggacgatctacagctcataatgacg
cataggaagggggtggacagctcagaggtgcatgggctggcgtggaacacattcaagaaa
tgcgctgatgcagccaaggaactgggcctctacggggcgggccaggatctgcttaaggac
gctttctccgggaatctcaggggaatgggaccgggagtggctgagatggagttcgaggag
aggccctcagatccaatagtagtcttcatggctgataaaactgagccaggggcctttaac
ttgccgatattcaagatattcgcggatcccttcaacacggctgggctcgtaatagatcct
aaacttcactcgggcttcatattcgagataatggatgttattgagagtaaggtggtggag
ctatcctcccctgaggatatgtatgatatattatcgataatagggacgccctcgaggtac
gtgataaagagggtcttcaggaaggtcgatagagagatagctgcctcaatcagcacgacg
aggctcagcctaatagctgggaagtacgtgggtaaggatgatcctgttgcgatagtaagg
gcccaagcaggattcccggcattgggtgagatactcgagcctttctccttccccttctta
gtggctggatggatgaggggctctcatgcaggccctctgatgccagtgagtgagagggat
gcgaggccgactaggttcgatggcccacctaggatagtggccctaggattccaggtgaag
gactcgaagctcatagggcctagcgacctcttctcagacgtagctttcgatgagactagg
agaatggcgaacttcatagctgattacatgaggaggcacggccccttcatgcctcacaga
ctgggcccagaggagatggaatataccacgcttccggaagttctgaagaaattggagggg
aagttcaggcacgagtga

DBGET integrated database retrieval system