KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1468Help
Entry
Kcr_1468          CDS       T00668                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:kcr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kcr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kcr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kcr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:kcr00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1451071..1451757)
Genome map
AA seq 228 aa AA seqDB search
MHIPRLLINFKAYMESSGDRAVEISKSAERIWREMGVLIGVSPNIVDLRLISSSVEIPVF
AQHVDPIPAGAYTGHVPPILVKEAGARGSLLNHSEKQIPLRHIAESINMMRDLNLISIVC
SPTPSESAAVAALLPDAIAVEPPELIGSGIPVSKAKPEVILNSLRSVKAINSAIPLLCGA
GISSGDDVKAALELGSYGVLVASAVTKSPDPQRKIRELAEPIASFTRA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcatataccgagactgctgataaacttcaaggcgtacatggagtcatcgggcgataga
gcagttgagatatccaagtcggctgagaggatctggagggagatgggagttctgatagga
gtatccccgaatatagtggatctcagacttatttcctcctccgttgagatacctgtattc
gcacagcatgtggacccgataccagcaggcgcttatacaggacacgtcccccctatccta
gttaaggaagccggtgcgaggggctccctcctaaatcattcggagaagcagatccccttg
aggcacatagctgaatctataaacatgatgagggatttgaatcttatctcaatagtttgt
tcacccactccatccgaatccgctgccgttgctgctttattgccggatgcgatagctgtg
gagccgcctgaactcataggtagcgggattcccgtatctaaagcgaaaccggaggtaata
ttgaattccctgaggtccgttaaggcgataaattctgctatacccctcctctgcggcgct
ggaatatcgagcggtgatgatgtcaaagcggctttagagctaggaagctacggggtcctt
gtggcttcagcagtaactaaaagcccggatcctcaaagaaaaataagggaattggctgaa
ccaatagcatcattcactcgtgcctga

DBGET integrated database retrieval system