KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1556Help
Entry
Kcr_1556          CDS       T00668                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kcr_1556
  Amino acid metabolism
   00300 Lysine biosynthesis
    Kcr_1556
Enzymes [BR:kcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Kcr_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1541542..1542747)
Genome map
AA seq 401 aa AA seqDB search
MPSLSEDEGMILFLMDLVRIDTNASERRNYWEIVKLIRDRAESIGMRTHIQVFRDERGDL
PNLIAWKDLGAEKNLLLLSHYDVVPAKGPWRINGMEFDPFDPRRVDGRIYGRGAADDKSA
IALSLSACQIVMEGGEAEYNPIVAVVGDEEVGGTGVTALADGGLDEAGIRPDAVVVIDAA
PDFVGIGASGVIHGDIIVRGRGGHAGRPFSSLNPINMAIKLADELLTGFSQIHAMKLSKI
PSPPDSPVPKLWGRFSITKVEAGTQHNVIPSEATIGFDIRFIPDEDKEEVIERFKAALSA
ASCKIGADVELKIKDTANPGWMTDPDNDFVRDVLASYEKHFGSRAIAGSLGGNDGFVFAR
KGIPTVSLGTIEIESNAHGELENVREDIILKMRDTIVDLLT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctctctgaagacgagggtatgatactcttcctgatggatctcgtcaggata
gatactaacgcatcggagagaaggaattactgggaaatagttaagttaataagggataga
gctgaatcaatagggatgagaactcatattcaggtttttagagatgaaaggggagattta
cctaacttaatagcttggaaagacctgggggccgaaaagaatttgcttttactctcccat
tatgatgtagttccggctaaggggccttggaggatcaatggaatggagttcgatcccttc
gatcccagaagggttgatggcaggatctatggcaggggagccgctgatgataagtcggcg
atagctcttagcctctcagcttgtcaaattgtcatggagggaggggaggctgaatacaac
ccgatagtggctgttgtcggcgatgaggaagttggagggactggcgtcactgctttggct
gatggagggctagatgaagctgggatacgccctgatgctgtcgtagtgatagatgcggcc
cctgacttcgtcgggataggggctagcggggtcatacacggagatataatagtcagggga
aggggcgggcacgctgggaggcccttctcatccctaaaccctatcaatatggccataaag
ctagcagatgagctgctgacgggattctcccagatccatgcgatgaagctatctaagata
ccttctccccccgactcccccgtcccgaagctctggggtaggttcagcataaccaaagtg
gaagcggggactcagcacaacgtcataccgagcgaagccactataggcttcgacataagg
ttcataccggatgaggataaggaggaagtgatagagaggttcaaagcagcattgagcgct
gcttcatgcaagataggggctgatgtggagctgaagataaaggatacagcgaatcccggg
tggatgactgatcctgataatgacttcgtcagggatgtcctagcgagttatgagaagcac
ttcggatccagggctatagcaggatccttaggagggaatgatggtttcgtgttcgcgagg
aaaggtattcccactgtctcattgggcactatagagatagagagcaatgctcatggggag
ctggagaacgtgagggaggatataattttgaagatgagggacaccatagtcgatctgctc
acttga

DBGET integrated database retrieval system