KEGG   Candidatus Kinetoplastibacterium crithidii TCC036E: CDEE_0454Help
Entry
CDEE_0454         CDS       T02464                                 

Definition
uroporphyrinogen-III synthase uroS (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kct  Candidatus Kinetoplastibacterium crithidii TCC036E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDEE_0454
Enzymes [BR:kct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CDEE_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244004..244762
Genome map
AA seq 252 aa AA seqDB search
MIPYQKNKKIGVNVYSIPLISIIPLDKFEEVFLPNNYDFVIFVSGNAVRLYLKEVFEKKI
SIWPLNSIAAAVGPATAKAFMYSRYIVSDIDKIQILFPNEFGNIYDSESLFALLKHNYSL
LRKRILVVRGISGRNWLIDKLKESGCFVDICPIYLRKKELLLRSQLSIISKIYSESKEVI
WVFTSNEIVSSFFLNLKHFYKNEFFEKSSFIVIHYKIKEFLESCFLGIGFKDLNIKICDP
VEESISFAITSD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgattccttatcaaaaaaataaaaaaataggagttaatgtttattctattcctttgata
tcaattattcctttagacaaattcgaagaagtttttttgcctaataattatgattttgtg
atttttgtaagtggtaatgctgttagattgtacttaaaagaagtttttgaaaaaaaaata
tcaatttggcctttaaattcaatagctgctgcagttgggcctgctacagctaaagctttt
atgtattcaagatatattgtttccgatatagataaaattcaaattttatttccaaatgag
tttggtaacatctatgattcagaatcactgtttgcattattaaaacataattattcttta
ttaagaaagagaattcttgtagtaagaggtattagtggaagaaactggttaatagataaa
ttaaaagagtcaggatgttttgtagacatatgccctatttatctaagaaagaaagaattg
ttactgcgtagccaattatctatcattagtaaaatatatagtgagtccaaagaggttatt
tgggtttttactagcaatgaaattgtttcatcattttttttaaatttaaaacatttttat
aaaaatgaattttttgaaaaatcttcttttatagtaatacattataaaattaaagaattt
ttagaaagttgtttcttaggtataggatttaaagatttgaatattaaaatttgcgaccct
gtagaagaatcaatttcttttgctattactagtgattaa

DBGET integrated database retrieval system