KEGG   Candidatus Kinetoplastibacterium crithidii TCC036E: CDEE_0481Help
Entry
CDEE_0481         CDS       T02464                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kct  Candidatus Kinetoplastibacterium crithidii TCC036E
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:kct01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:kct01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268285..269487
Genome map
AA seq 400 aa AA seqDB search
MDKIISFISSGFTQASALQVLMFTLFVTHITIIGVTVFLHRSQAHRALDLHPVIMHFFRF
WLWMTTGMITKEWVAIHRKHHAKCEREGDPHSPMIYGIWKVFFQGAELYREEAANIDTLS
RFGRGTPDDWIERNIYSKHSSLGILIMLFIDIFLFGVLGLSVWAVQMAWIPFWAAGVVNG
MGHYFGYRNFASPDTSTNLFPIGFIISGEELHNNHHAFATSAKFSSKWYEFDLGWCYINI
MRFFRLAKIKKIAPKLVLSNYDRNIDLSTLHGVIVHRYELMTQYADIIKDVVHQELKELK
KYSCSDSRYERLKSINSYLYKHESIMQPKQLAEVDNVVSSSKSLFVLIQMRRDLGRIWEG
SSLTSDQLVLHLKSWCDRAKNSEVCGLQKFASKLNRYSIV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaattatttcatttatttcatcgggttttactcaggcttctgctttgcaggtt
ttgatgtttactctatttgttactcatataacaattattggtgttactgtttttttgcat
agaagtcaggctcacagagcgctagatcttcatccagttataatgcatttttttcgtttt
tggttgtggatgacaactggaatgataacaaaggaatgggtagcaatacatagaaaacat
catgccaagtgtgaaagagaaggtgacccacattcacctatgatatatggaatatggaaa
gtattttttcaaggagcagagttatatcgggaagaggctgctaatattgataccttatct
agatttggtagaggcacacctgatgattggattgaaagaaatatttattcaaaacatagt
agtttaggtatcttgattatgttgtttatagatatttttctatttggagttcttggttta
tctgtatgggctgtccaaatggcttggataccattttgggctgctggtgttgttaatgga
atgggtcattattttggctatcgtaattttgcttcgcctgatactagtactaatttattt
ccaataggttttataatatctggtgaggaattacataataatcatcatgcttttgctact
tcagcaaagttttcttccaagtggtatgaatttgatttgggctggtgttatataaatatc
atgagattttttcgacttgcaaagataaaaaaaatagcgcctaaattagttttaagtaat
tatgatcgtaatattgatctttctacacttcatggagtaatagttcatagatatgaatta
atgactcaatatgctgatattatcaaagatgtcgtgcatcaggaacttaaagaattaaaa
aaatactcatgcagtgattctcgctatgagcgtttaaagagtattaatagctatttatat
aagcatgagtcgataatgcaacctaagcaacttgcagaggtagataatgttgtttcatca
agtaaatctttatttgtattaatacaaatgcgtagagatttaggtcgtatttgggaaggt
tcttccttaaccagtgatcagcttgttttgcatttaaagtcttggtgtgatcgtgccaaa
aatagtgaggtttgtggattacaaaaatttgcttctaaattgaatagatatagtattgta
tga

DBGET integrated database retrieval system