KEGG   Candidatus Kinetoplastibacterium crithidii TCC036E: CDEE_0481Help
Entry
CDEE_0481         CDS       T02464                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kct  Candidatus Kinetoplastibacterium crithidii TCC036E
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kct00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDEE_0481
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CDEE_0481
Enzymes [BR:kct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CDEE_0481
Lipid biosynthesis proteins [BR:kct01004]
 Desaturase
  First
   CDEE_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268285..269487
Genome map
AA seq 400 aa AA seqDB search
MDKIISFISSGFTQASALQVLMFTLFVTHITIIGVTVFLHRSQAHRALDLHPVIMHFFRF
WLWMTTGMITKEWVAIHRKHHAKCEREGDPHSPMIYGIWKVFFQGAELYREEAANIDTLS
RFGRGTPDDWIERNIYSKHSSLGILIMLFIDIFLFGVLGLSVWAVQMAWIPFWAAGVVNG
MGHYFGYRNFASPDTSTNLFPIGFIISGEELHNNHHAFATSAKFSSKWYEFDLGWCYINI
MRFFRLAKIKKIAPKLVLSNYDRNIDLSTLHGVIVHRYELMTQYADIIKDVVHQELKELK
KYSCSDSRYERLKSINSYLYKHESIMQPKQLAEVDNVVSSSKSLFVLIQMRRDLGRIWEG
SSLTSDQLVLHLKSWCDRAKNSEVCGLQKFASKLNRYSIV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaattatttcatttatttcatcgggttttactcaggcttctgctttgcaggtt
ttgatgtttactctatttgttactcatataacaattattggtgttactgtttttttgcat
agaagtcaggctcacagagcgctagatcttcatccagttataatgcatttttttcgtttt
tggttgtggatgacaactggaatgataacaaaggaatgggtagcaatacatagaaaacat
catgccaagtgtgaaagagaaggtgacccacattcacctatgatatatggaatatggaaa
gtattttttcaaggagcagagttatatcgggaagaggctgctaatattgataccttatct
agatttggtagaggcacacctgatgattggattgaaagaaatatttattcaaaacatagt
agtttaggtatcttgattatgttgtttatagatatttttctatttggagttcttggttta
tctgtatgggctgtccaaatggcttggataccattttgggctgctggtgttgttaatgga
atgggtcattattttggctatcgtaattttgcttcgcctgatactagtactaatttattt
ccaataggttttataatatctggtgaggaattacataataatcatcatgcttttgctact
tcagcaaagttttcttccaagtggtatgaatttgatttgggctggtgttatataaatatc
atgagattttttcgacttgcaaagataaaaaaaatagcgcctaaattagttttaagtaat
tatgatcgtaatattgatctttctacacttcatggagtaatagttcatagatatgaatta
atgactcaatatgctgatattatcaaagatgtcgtgcatcaggaacttaaagaattaaaa
aaatactcatgcagtgattctcgctatgagcgtttaaagagtattaatagctatttatat
aagcatgagtcgataatgcaacctaagcaacttgcagaggtagataatgttgtttcatca
agtaaatctttatttgtattaatacaaatgcgtagagatttaggtcgtatttgggaaggt
tcttccttaaccagtgatcagcttgttttgcatttaaagtcttggtgtgatcgtgccaaa
aatagtgaggtttgtggattacaaaaatttgcttctaaattgaatagatatagtattgta
tga

DBGET integrated database retrieval system