KEGG   Candidatus Kinetoplastibacterium desouzaii: CDSE_0447Help
Entry
CDSE_0447         CDS       T02465                                 

Definition
uroporphyrinogen-III synthase hemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kde  Candidatus Kinetoplastibacterium desouzaii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDSE_0447
Enzymes [BR:kde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CDSE_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247121..247915
Genome map
AA seq 264 aa AA seqDB search
MSFPQTVVLTRPENYSLYNKLKNIGIDVYSMPLLLVEPIKSSDIKMPNNYDFVVFVSGNA
IKFYLKKIYNNIGMFSWPSSTFVATVGPSSAKTFRCSKYLYNKENIVMLYPDQADSTYDS
ESLYCFLNNKFFLSGRRFLIVRGLSGRNWLIEKLRENNFVDVCHVYNRKSVFLSSVYLNL
IHKWIKQKKNIVWVFTSQEIVSSFFSNLKSIDCIDWLTNCFFLVTHKKIMSALSSQLLSI
KVYTQNIRICDPIEDSILDMLANN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcccccaaactgttgttcttacaagaccagaaaattattctttatataacaag
ttaaaaaacattggaatagatgtttatagtatgccgttgttgttagttgaaccaataaaa
tcatctgacatcaaaatgcccaataattatgattttgttgtttttgttagtggtaatgct
attaaattttacttaaagaaaatttataataacattggtatgttttcctggccttcttcc
acttttgtagctacagttggaccatcttctgctaagacttttagatgttctaagtattta
tataataaagaaaatattgttatgttatatccagatcaggctgattctacttatgattct
gagtctttatattgttttctaaataataaattttttttaagcggtaggcgttttcttatt
gttagaggtttgagtggtcgcaattggttaatagaaaaattaagagaaaataattttgtt
gatgtatgtcatgtttacaataggaaaagtgtttttttgtcgagtgtttatttgaactta
attcataaatggattaaacagaaaaaaaatattgtttgggtttttacaagccaagaaatt
gtttcttcattttttagtaatttgaaatctatcgattgtattgattggttaactaattgt
ttttttttggttacacataaaaaaattatgagtgcattgagtagtcaattgttaagcata
aaagtttatactcaaaatataagaatatgtgatcctatcgaagattctattcttgatatg
cttgctaataattag

DBGET integrated database retrieval system