KEGG   Candidatus Kinetoplastibacterium desouzaii: CDSE_0473Help
Entry
CDSE_0473         CDS       T02465                                 

Definition
stearoyl-CoA desaturase (delta-9 desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kde  Candidatus Kinetoplastibacterium desouzaii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kde00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDSE_0473
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CDSE_0473
Enzymes [BR:kde01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CDSE_0473
Lipid biosynthesis proteins [BR:kde01004]
 Desaturase
  First
   CDSE_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271340..272530
Genome map
AA seq 396 aa AA seqDB search
MDKIISFITGGFTQASSLQIFLFTLLVTHITILGVTIFLHRSQAHRALDLHPFVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEREGDPHSPMIFGIWKVFFGGAELYREEAANQETLL
RFGKGTPDDWLEQNLYSKHSSLGIMITLVIDIALFGIVGLTVWAIQMAWIPFWAAGVVNG
AGHYWGYRNYNSPDTSTNLFPIGLIIGGEELHNNHHAFATSAKFSSTWYEFDLGWCYIRL
LSFLGLAKIKKIAPRLILSDSNRNIDLITLNGIITHRYEIMARYADIIKKVMNHELKTLR
NSHDCYIRLKKVNADLYKHESIINPEKLAEVDKAISSSKSLSILIEMRRDLAHVWDSSNL
TSEQLLSYLKTWCKRAQMSGICDLEKFAFSLKRYVV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattatttcttttataactggtggtttcacacaagcttcgtctttgcagatt
ttcttatttactcttttggtaactcacatcactatactcggggttacaatttttcttcat
agaagtcaagctcatagagctttagatttacatccttttgttatgcatttttttcgtttt
tggttatggatgacaaccggcatggtaacaaaggagtgggttgctatacatcgtaagcat
catgctaaatgtgagagagaaggcgatcctcattctcctatgatttttggaatatggaaa
gttttttttggtggagctgagctttatcgtgaggaagctgctaatcaagaaacattatta
agatttggtaaagggacgcctgatgattggttagagcaaaatctttattcaaaacatagt
agtttgggaataatgattactctagtcatagatatagctctttttggtattgtaggacta
acagtttgggctattcagatggcttggatacctttttgggctgctggtgttgttaatggg
gcaggtcattattggggttatcgaaattataatagtccagatactagcactaatttgttt
cctataggcttgataataggaggagaggagttgcataacaatcaccatgcttttgctact
tcagcaaagttttcttctacttggtatgaatttgatttgggatggtgttatataagatta
ttatcatttttaggtttggctaaaataaaaaaaatagcccctagacttattttgagtgat
tctaatagaaatattgatctgataacattaaatgggattattactcatagatatgaaata
atggcaagatatgctgatattattaagaaagttatgaaccatgaattaaaaacacttaga
aattctcatgattgttatattagattaaaaaaagtaaatgctgacttatataagcatgaa
tcaataattaatccagaaaaattagcagaagttgataaggcaatatctagtagcaagtct
ttatcaattcttatagaaatgcgtcgtgaccttgctcatgtttgggatagttctaatctt
actagtgagcaacttctttcttacttaaaaacttggtgtaaacgagcacaaatgagtggc
atttgtgatttagagaagtttgcatttagcctaaaacgttatgtcgtatga

DBGET integrated database retrieval system