KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0055Help
Entry
Krodi_0055        CDS       T01484                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Krodi_0055
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Krodi_0055
Enzymes [BR:kdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Krodi_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59016..60563)
Genome map
AA seq 515 aa AA seqDB search
MVLRFLVLVICFSFFSCKKEKPLVQTSIEKLVLIPIPDQIVAEDYGFLFDQETRVMSDTL
PEVQAIATQFKNLLKQTPFPLTLDNEVDENVVSFNIVSSDSIPSPEGYALAINNKRLSLA
GSTPSGVFRGMQTLLQVLPDALIAGKQIDSLVIPGLKIVDAPQYEYRGMMLDVARHFFTV
DEVKRLIDQMAFYKLNKLHLHLTDDQGWRIEIKSWPKLTEIGGSSSVRNERPGFYTQEDY
KSIVAYAQSKFITVIPEIDMPGHTNAALASYPELNCNGKVTKLYKGMRVGFSTLCVDKDI
TYTFVENVIKEIAAMTPGPYIHLGGDESHVTSKKDYNIFLNKVFPIVKKYNKHVIGWEEI
ESAGVDSTYIVQHWQRTTTASRGLTQGAKVILSPAKRMYLDMKYTKKSPIGLTWAGTVEL
DSAYIWNPSQIFKNVPVSQVLGIESPLWSETIKSSDDIEYLAFPRLIGHAELGWSNPSNY
NWDSYKKRLYKHYKRMDILEINYYNSPILETKIKL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggttttgagatttttagtgctagttatttgtttctcgtttttctcttgtaaaaaggag
aaacctcttgtgcaaacaagtattgaaaagctcgttcttatcccaattccagatcagata
gttgcagaggattatggctttttatttgatcaggaaactagagtgatgagtgatacattg
ccagaagtgcaagcaattgccacgcagtttaaaaatcttttaaaacaaacaccttttcca
ttaacactagataatgaagtagatgaaaatgtagtttcatttaatattgtgtctagtgat
agtataccttccccagagggatatgcacttgctataaataataagagattgtcgcttgct
gggtcaacacctagtggtgtctttaggggtatgcaaacgctattgcaagttttaccagat
gctcttattgcaggaaagcagattgatagtctagtcatcccaggactaaaaattgtagat
gcaccgcagtacgagtatagaggtatgatgctagacgttgcacgtcacttctttaccgta
gatgaagtaaagcgtctcattgatcaaatggcattttataaacttaataaattacactta
cacttaaccgatgaccaagggtggcgtattgagatcaagtcatggcctaaacttacggaa
ataggagggagctcgtctgtgcgtaatgaacgccctggattttatactcaagaagattat
aaatcgattgtagcttatgctcagtcaaaatttattacggtgattccagagattgatatg
cctggacatactaatgcagcactggcatcttatcccgagctcaactgtaatggtaaagtc
acaaagctgtataagggaatgcgtgtaggttttagcaccttgtgcgtagataaagatatt
acatacacatttgtagaaaatgtgataaaggaaatagcagcaatgacccctgggccatat
atacatctaggaggtgatgaatctcacgtcacttcaaaaaaggattataatatatttctc
aataaagtgtttccaatagttaagaagtacaataaacacgtaataggctgggaagagata
gaaagtgctggtgtagatagcacttacatagtacaacactggcaaagaaccactaccgca
tcgcgaggacttactcaaggtgcaaaagttattttatctcctgcaaagcgtatgtatctt
gatatgaaatacacaaagaagtctcctataggacttacttgggccggaacggttgagtta
gatagcgcttatatctggaatccatcacaaatttttaaaaatgttcctgtctcacaagtg
ttgggtattgaatctcctttgtggtctgagactataaaatcctctgatgatattgagtat
cttgcttttccaagactcataggtcacgccgaattaggctggagtaaccccagtaattat
aattgggattcttataagaagcgattatataagcattataagagaatggatatactagag
attaactattataattctccaatactcgaaactaaaatcaagctgtag

DBGET integrated database retrieval system