KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0259Help
Entry
Krodi_0259        CDS       T01484                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kdi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297383..298312
Genome map
AA seq 309 aa AA seqDB search
MKTYAGIPQEYAGAEKAKIVLLPVPYDGTSTWGKGADKGPEAFLHASENMELYDIETESE
VYKQGIHLADPIKENTSPEAMVEAVHKIVKKNIKRNKFVTMFGGEHSVSIGAIRAFNETF
DNLTVLQLDAHADLRESYEGSTCNHACAVYEANQTTNLVQVGIRSMDAIEKTVMNEDNVF
FAHEMATDDYWMDNAIEAMTENVYVTFDLDAFDPSVLSATGTPEPGGLFWYETLDFLRRV
FAEKNVVGFDIVELCPNGNSKPSEFAAAKLYYKMLSYKFEQEDAGEEYEVSGLQEKSKKI
NQEEDDYND
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtacgcaggcataccacaagaatatgcaggagctgaaaaagctaaaattgtt
ttacttccagttccttatgacggaactagtacttggggcaaaggagcagacaagggtcct
gaagcatttttacatgcttctgaaaatatggagctttacgacatagaaactgaaagcgaa
gtttacaaacaagggatacaccttgcagatcctatcaaagaaaatacatcaccagaagca
atggtggaagctgtacacaagattgtaaagaaaaacattaaacgtaacaagtttgttacc
atgtttggtggagagcattctgtatctataggtgctattcgtgcatttaatgaaacattt
gataatcttacggtattacaactagatgcgcatgcagatttacgtgagtcttatgaaggt
tctacttgcaatcacgcttgtgccgtgtatgaagcaaaccaaactacaaatcttgtacaa
gtaggaatacgtagtatggatgccattgaaaaaacagtgatgaatgaagataatgttttc
tttgctcacgagatggcaacagacgattactggatggataatgcgattgaggcaatgaca
gaaaatgtatatgtaacatttgatctagatgcctttgatccatctgtactttctgctact
ggaactccagaacctggaggattattctggtatgaaacgttagacttcttacgtcgcgtg
tttgcagagaagaatgttgtaggttttgatattgtagagctttgccctaatggaaatagc
aagccttctgagtttgcagcggcaaaattatactacaaaatgcttagctataagtttgag
caagaagatgctggagaagagtacgaagtaagcggattacaagaaaaaagcaaaaaaatt
aatcaagaagaagacgattataatgactaa

DBGET integrated database retrieval system