KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0263Help
Entry
Krodi_0263        CDS       T01484                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00260  Glycine, serine and threonine metabolism
kdi00750  Vitamin B6 metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01230  Biosynthesis of amino acids
Module
kdi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krodi_0263
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Krodi_0263
Enzymes [BR:kdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Krodi_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE18250
UniProt: F4AXY3
Position
300234..301295
Genome map
AA seq 353 aa AA seqDB search
MNLKDGVKSSDNKVSSEAMALSLFVKDTTKSLTDRLESYEDIINLEVGDTGLTRAKSLER
EFDIRQLYIKYEGDNPTGTQKDRIAFAQVYDALRRDFHTMSLATCGNYGVAVALAAKLGG
IACNIYIPESYHTDRIIEMERLGATIFRLQGSYEEVVTASSKLAQEHEWYDANPGGANTP
LQISAYSQIAVEIVDELGDAPQYCAAPVSNGTLFAGIYRGFVSLYKRGKTSRIPKMIAAS
STGKNPIIQSHKEGLDHCRDLDPDKIKETKYNEPLINWHSFDGEEALYAIQQSDGKAFNI
SDKKMREMSTLLLKKEGLRILPASTAGLIALLELDEKENLAPDRFVAVLTAKN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaaagacggtgtaaaatcatcagacaataaagtatcctcagaagcgatggca
cttagtctgtttgtaaaagacaccacaaaatcacttacagaccgtttagaatcttacgaa
gacattatcaacttagaagtaggcgatacgggtcttacaagagcaaaatctcttgaacgt
gagtttgatattagacaattatacatcaaatacgagggtgataaccctacgggaacacaa
aaagatagaattgcctttgcacaagtttatgatgcgctgcgcagagattttcacaccatg
tcactcgccacctgcggtaactacggtgtcgcagttgcacttgctgcaaagttaggcgga
attgcttgtaacatttacatcccagagtcctatcacacagatcgtatcatagagatggaa
cgtctaggagctacgatttttaggctacaaggtagttatgaggaggtagttactgccagc
agcaaactagcacaagaacatgaatggtatgacgcaaatcctggaggtgcaaacacaccg
ttacagatatctgcatactcacaaattgctgtagagattgtagatgagctgggtgatgcg
ccacagtattgtgctgctccagtatctaatggaactttatttgctgggatttatagaggc
tttgtgagtttatacaaacgaggtaaaacctctcgcattcctaaaatgattgcagcttct
tctacaggtaaaaatcctattattcaatctcataaagaaggactagaccactgtcgtgat
cttgatccagataagattaaagaaactaagtacaatgagccacttataaactggcacagc
tttgatggagaggaagctctgtatgctatccagcaatctgatggaaaagcatttaacatt
agtgataaaaaaatgcgagagatgagtacgctcctacttaaaaaagagggactacgcatt
cttcctgcatcaactgctgggcttatcgctctcttagaacttgatgagaaggagaacctc
gctccagatcgttttgtagcagtacttaccgcaaaaaattaa

DBGET integrated database retrieval system