KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0281Help
Entry
Krodi_0281        CDS       T01484                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kdi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319558..321471)
Genome map
AA seq 637 aa AA seqDB search
MAEVIAHSLFTAFDIDLFKGGKHYRLHDKMGSHPITVDGVDGTYFSVWAPSAKRVSVVGD
FNYWNEEEHILNVRWDGSGIWEGFIPEIAHGEVYKYKIHSNHNDVVTEKADPYARRAEHP
PQTASVVYKTNHNWKDAAWMKKRHKHNSLNAPYSVYEMHLASWRRKQDEGNRSLSYTELA
SELVAYVKELNFTHVEFMPVMEHPYDPSWGYQITGYFAPTSRFGYPEELMTLIDALHQND
IGVILDWVPSHFPEDAHGLGNFDGTACYEHPDRKKGWHPDWKSLIFNYERNEVRSFLISN
ALFWLEQYHVDGLRVDAVASMLYLDYSREEGEWEPNDQGGRENLAVISFLKELNAEVYAS
FPDVQTIAEESTNFPAVSRPVFSGGLGFGQKWMMGWMHDTLAYFKRDTIYRNHHHNEISF
SMTYGFTENFMLPLSHDEVVYGKKSIIGRMPGDEWQRFANLRLLYTYMYTHPGSKLLFMG
SEFGQGTEWNFQEQLDWYVLEYDIHKAALSAFKDINGLYTLTPALYEKQFEPEGFEWIAH
DDNTNAILSYIRKGNDENSVVVCVFNMTPTPQPQYRIGLPFKGSLREIHNSDASKYAGTG
DYHNKKLDVTETYWNGKDHSAEVKIGPLAGVIFELKK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatagcacatagcttatttacagcatttgacattgacctttttaaggga
gggaaacactatcgtcttcatgataaaatgggtagtcaccccataactgtagatggtgta
gatggaacttatttctccgtatgggcacctagtgcaaagcgagtatctgttgtaggtgat
tttaattactggaatgaggaagagcatattcttaacgtgcgatgggatggaagcgggatt
tgggaaggttttattcctgagatcgctcatggtgaagtatacaaatacaaaattcattcc
aatcacaacgacgttgtcacagaaaaggcagacccttacgcgagacgagcagagcaccca
cctcaaaccgcttctgtagtttataaaacaaatcataactggaaggatgctgcatggatg
aaaaaacgccataagcacaacagtcttaatgcgccgtactctgtgtatgaaatgcacctt
gcaagctggagaagaaagcaagatgaaggaaatcgtagccttagctatacagaactagcc
agcgaactcgtggcttatgtgaaagaattaaactttacacatgtggagtttatgccagtg
atggagcatccttatgatcccagctggggatatcaaattacaggatattttgcgcctacc
tctcgatttggatatcctgaagagttaatgactttgatagatgcgttgcaccaaaatgat
attggggtaattttagactgggtaccttctcattttccagaagatgcgcatggtcttggt
aactttgatggaacagcctgttacgagcacccagatagaaagaaaggatggcatcccgac
tggaagtcacttattttcaattacgaacgtaatgaagtgagaagcttcttgattagtaat
gcgctcttctggttagagcaatatcatgtagatggcttgagagtagatgcggttgcttct
atgctatatctcgattatagtagagaagaaggcgagtgggagcctaatgatcaaggagga
agagaaaacctcgccgtaatatcgtttctaaaagaacttaatgcagaggtgtatgctagt
tttccagacgttcaaaccattgcagaggagtctactaattttccagcagtgagtaggcca
gtattttcaggaggtctaggttttggtcaaaagtggatgatgggatggatgcatgataca
cttgcttatttcaagagggacactatctatagaaatcatcaccacaatgagattagcttc
tcaatgacctatggttttacagagaactttatgctaccattatctcatgatgaggtggtc
tatggtaaaaaatctattataggtagaatgcctggagatgagtggcaacgctttgcaaat
ctcaggcttttgtatacgtatatgtatacgcatcctggtagtaagttactgtttatggga
agcgaatttggtcaaggtacagagtggaattttcaagagcagctagattggtacgtgctt
gaatatgatattcacaaagcagcactaagtgctttcaaggatattaatggcctgtataca
ttgacacctgctttgtacgagaagcagtttgaaccagaaggtttcgaatggattgcacac
gatgataatacaaatgccatactaagttacattagaaagggcaatgatgagaatagcgta
gttgtgtgtgtgtttaatatgacacctacaccgcagcctcaatatcgcatagggttacct
tttaaaggaagcttacgcgaaatacataacagcgacgcaagtaagtatgctggaacaggt
gattatcataacaaaaaactcgatgttaccgaaacctattggaatgggaaagaccattcg
gcagaggtaaaaatagggcccttggcgggagtgatttttgagctgaaaaagtag

DBGET integrated database retrieval system