KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0362Help
Entry
Krodi_0362        CDS       T01484                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:kdi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:kdi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(425119..428721)
Genome map
AA seq 1200 aa AA seqDB search
MEDTQNKKHIIVAVGASAGGLEALNAFFNNVVENYDYSYIIIQHLSPDHKSLMAELLSKK
TNVPIVAVTNDSEIKRSHIYVIPPSMNLIIENGHLILLNKPVAKTLNLPIDLFMSSLAEA
YGKEAVGVILSGTGSDGTKGVQAIKEHGGVVLVQQPDEASFDGMPTSAINSGNVDYIVPA
GEMIDEIHRYFNNEDVFNFKEDISTEDNERLRSILNILHTNTNINFNYYKRPTILRRTER
RMQNLKMGSFDQYIAYLKIHPEEVSVLYREFLIGVTKFFRDTNAWNLLEAETIPGIVRNK
RDGDTIKVWDVACSTGEEAYSMALLFQEEIDRQEKDIKLKIFATDISEEHIALASQGVFS
NTIVQSVSPSKLQKYFIKDGEEYKVAKDLRKKIIFSNHDILKDPPFKNMDMVSCRNLLIY
LKPEVQTAVLHTLHYALKLNGFLFLGSSESITALRNSFETINGKLKIFKNIHPSERLHSE
LLTSNADKSDFLLSRKQKKTVIHKKETFTNDIKMSISNVLLSQFDTASVYVDADFKVLDA
LGSFSKYAQLPESGFSLDLLKMLPDNLKTAVNSAARKAKRSKKDFIYNDVITPKAGADTV
VNVLVKPVFQNNTDDCNYVVTFIEKELNPDSAVARGTMNLAVAPDERIKDLIDEIEETRG
ELKKALEDAETSNEELQTLNEELLASNEELQSTNEELQSVNEELHTVNVEHIEKMDDLAL
LNADMDNILNSTQIATIFLDRQLTIRKFTPSIQEHFKLMKQDVGRPIDHFLTQLGTGRKS
SLRSKIETVMSTGEVNETQIDKKGGRSYIRRISPFYTGTNKIEGSVIAFVDITKTVDSQK
KLKESQQKFKDFYENDPVMHVSVDPSTGRIVECNKIFIETLGLNSRSEVVGRRIFDFYTD
DSKAKGLGLLDEIQRTGVIEGEQMTLIDTEGNEIPIILNSELVIPEEGNSYSRSTLINIS
DLQRAQQLMYDKNEELQRINTDLEQFVSICSHDLQEPLGTIRFSSDVILKKFGDDLDPKA
AEYLGYIYGAAGRMANQIKGLLEHSRIGQELERTEVNVQELLEIVKYDLGKRLRECGGKI
HLSKMPTIQAYNTELRLLFQNLIGNSLKYSKPDVSPIVRISSFEDEGYWTFVINDNGIGI
AEEDLDQVFKIFGRASTQHKYEGTGVGLAHCEKIVKLHDGSIWVDSQLNVGSTFYFKIKK
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
ttggaagacacacaaaataagaagcatataattgttgctgtaggagccagtgctggtggc
ctagaggctcttaatgccttttttaataatgtagtagaaaattatgattacagttatata
atcatacaacatttatcgccagaccacaaaagcctcatggcagagttgttgtcaaaaaaa
acaaacgttcctattgtcgctgttacaaatgactctgaaatcaaaagaagtcatatatat
gttatacctccttcaatgaatctcatcattgaaaatggacatcttattttattgaataaa
ccagtagccaaaacgctcaatcttcctatagatttattcatgagttcccttgcagaagct
tatggaaaggaagccgtaggcgttatattgagtggtacaggtagtgatggtacaaaaggc
gtgcaagctatcaaagaacatggaggagttgtacttgtacagcaaccagatgaggctagc
tttgatgggatgcctacaagcgctataaatagtggtaatgtagactatattgtgcccgca
ggagaaatgatagatgaaatacatcgctattttaataatgaggatgtgtttaattttaag
gaagatatttctacagaagataatgaacgtttgcgttccattttaaatatcctccatact
aatacaaatataaatttcaattactacaagcgtcctacgattctgagacgaacagaaagg
cgtatgcaaaaccttaaaatgggtagttttgatcaatatatagcatatcttaaaattcat
ccagaagaggtttctgtgttatatagggagtttttaataggagtcacaaaattttttaga
gatacaaatgcttggaatttactagaggcggagaccataccaggtattgtaagaaataaa
agggatggagatactataaaagtttgggatgtggcttgctctacaggagaagaggcatat
tcaatggcgttgctttttcaagaagaaatagatcgtcaggaaaaggatataaagctcaaa
atatttgctacagatatttctgaagagcacatagcacttgcatctcaaggagtttttagt
aataccattgttcaaagcgtttctccaagtaaattacagaagtactttattaaagatgga
gaagaatataaggttgctaaagatcttagaaagaaaattattttctctaatcatgatatt
ttaaaagaccctccatttaaaaatatggatatggtctcatgccgtaatcttttgatttac
ttaaagccagaggtgcaaacagcggtattgcatacattacactacgcattgaaacttaat
ggatttttgtttttaggttctagtgagtctattactgccttgcgtaattcctttgagaca
atcaatgggaagcttaaaatttttaagaatatacacccatcagagagattgcatagtgag
ttacttacttcaaatgcagataagagtgactttctactttcgcgaaagcagaaaaaaacg
gtaattcacaagaaagaaacatttaccaatgatattaaaatgagtataagcaatgtgctt
ttatctcaatttgatactgctagtgtatatgtcgatgcagactttaaagtactagatgct
ttaggttctttttctaagtatgcacaattaccagaaagcggtttttctttagacttacta
aagatgcttcctgataatttgaaaacggcagtaaactcggctgcgagaaaagcaaagcgt
tctaaaaaagactttatttacaacgacgtgattaccccaaaggcaggtgccgataccgtt
gttaacgtactggtaaaacctgtttttcaaaataacacagatgattgcaactacgtagta
acatttattgaaaaggaattaaatccagactcagctgtagctcgtggcacaatgaatctt
gcggtagctccagacgagcgtattaaagaccttatagacgagatagaagaaacaagagga
gagcttaaaaaagcgctagaggatgcagagactagtaatgaagaattacaaacgctcaat
gaagagttgcttgcctcaaatgaagaattgcagagcacaaacgaggagttgcagagtgta
aatgaagaattgcatactgtaaatgtggagcatattgaaaaaatggatgatctcgcattg
cttaatgcagatatggacaatattcttaatagtactcagatagctacaatctttctagat
aggcaacttacaattagaaaatttacaccttccatacaagaacatttcaagttaatgaag
caagatgtagggagacctatagatcacttcttaacccagttaggaacagggagaaaatcg
tcacttagaagtaagattgaaacagtgatgagtacaggtgaggtaaatgaaacacaaatt
gataaaaaaggtggacgctcttatatacgacgtatttctcctttctatacagggactaat
aaaatagaaggatctgtaatcgcctttgtagacattaccaaaacggtggattcacaaaag
aaattaaaagaaagccagcagaagtttaaagatttttatgaaaatgatcctgtgatgcac
gttagtgtagatccttctacaggacgtattgtagaatgtaataaaattttcatcgagacg
cttggcttaaattctcgtagcgaagttgtaggtaggcgtatatttgatttctacacagac
gattctaaggctaaaggccttggtctcttggatgagattcaaagaactggagtgatagaa
ggtgagcaaatgacccttatagatacagaaggtaacgagattcctattattcttaattct
gagctggtgattccagaagaaggtaactcgtactcgcgttctaccttaataaacatatca
gatttgcagcgtgcacagcagttaatgtatgataagaatgaagagttacaacgcattaat
acagacctagaacagtttgtatccatatgttcacatgacttacaagaacctttgggtacg
atacgctttagtagtgatgttattctaaagaaatttggagatgatctagaccctaaggct
gccgaatacttgggttacatctatggtgcagcaggtagaatggcaaaccaaatcaaagga
cttctagagcatagccgcatagggcaagaactagagcgtacggaagtaaatgttcaagaa
ctactagagattgtaaagtatgatctcggcaaaagactgagagagtgtggtggtaaaata
catcttagtaaaatgcctactatccaggcttataatacggagttgaggttattgttccag
aacttaataggtaactcactcaaatattcaaagccagatgtaagtcctatagtgcgtatt
tcatcttttgaagatgaagggtactggacctttgtgatcaatgacaatggtataggtata
gccgaagaagatcttgaccaggtttttaaaatttttggtcgtgcatccacccagcataaa
tatgaaggtactggtgtcggtcttgcacactgtgagaaaattgtaaaacttcacgatggc
tcaatatgggtggactctcagttaaatgtaggtagtacattttatttcaaaattaaaaaa
taa

DBGET integrated database retrieval system