KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0390Help
Entry
Krodi_0390        CDS       T01484                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kdi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
458992..459693
Genome map
AA seq 233 aa AA seqDB search
MKTDLDRGIQVDDASLLNEEIGDNHVATSAITPLRDDAFEMSNADKMASIQEDVAHIMQT
LGLDMTDDSLKGTPKRVAKMFVNEIFAGLHPDNKPKVSVFDNNYKYGEMLVEKNITVYST
CEHHLLPIVGRAHVAYISNGTVVGLSKMNRIVDYYAKRPQVQERLTMQIVQELQRAMGTE
DVACVIDAKHLCVNSRGIRDIESSTVTSEFGGRFKDAATRREFLDYIKLDTDF
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatttagatagaggaatacaagtagacgacgccagtcttctcaacgaagaa
ataggcgataatcacgttgctacaagtgctattacaccattgcgtgatgatgcttttgag
atgagtaacgcagataaaatggcgagcattcaagaagatgttgcacatattatgcaaaca
ctaggtcttgacatgactgatgatagccttaaaggtactccaaagcgtgtggcaaaaatg
tttgtaaacgagatcttcgcaggtttacatccagataataaacctaaggtttccgttttt
gataataactataagtatggagagatgcttgtagaaaaaaatattacagtgtactctacc
tgtgagcatcacttactacctattgtaggtcgtgcacacgtggcttacatttctaacgga
actgttgtaggtcttagtaaaatgaatcgcattgtagattattatgcaaagcgtcctcaa
gtacaagagcgccttactatgcagattgtgcaagaattacaacgcgcaatgggaacagaa
gatgtagcctgcgttatcgatgcaaagcatctctgtgtaaatagtagaggaataagagac
atcgagagcagcacagttactagcgagtttggtggtagatttaaagatgctgctactcgc
agagaatttttagattacatcaagctagacacagatttttaa

DBGET integrated database retrieval system