KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0390Help
Entry
Krodi_0390        CDS       T01484                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Krodi_0390
Enzymes [BR:kdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Krodi_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
458992..459693
Genome map
AA seq 233 aa AA seqDB search
MKTDLDRGIQVDDASLLNEEIGDNHVATSAITPLRDDAFEMSNADKMASIQEDVAHIMQT
LGLDMTDDSLKGTPKRVAKMFVNEIFAGLHPDNKPKVSVFDNNYKYGEMLVEKNITVYST
CEHHLLPIVGRAHVAYISNGTVVGLSKMNRIVDYYAKRPQVQERLTMQIVQELQRAMGTE
DVACVIDAKHLCVNSRGIRDIESSTVTSEFGGRFKDAATRREFLDYIKLDTDF
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatttagatagaggaatacaagtagacgacgccagtcttctcaacgaagaa
ataggcgataatcacgttgctacaagtgctattacaccattgcgtgatgatgcttttgag
atgagtaacgcagataaaatggcgagcattcaagaagatgttgcacatattatgcaaaca
ctaggtcttgacatgactgatgatagccttaaaggtactccaaagcgtgtggcaaaaatg
tttgtaaacgagatcttcgcaggtttacatccagataataaacctaaggtttccgttttt
gataataactataagtatggagagatgcttgtagaaaaaaatattacagtgtactctacc
tgtgagcatcacttactacctattgtaggtcgtgcacacgtggcttacatttctaacgga
actgttgtaggtcttagtaaaatgaatcgcattgtagattattatgcaaagcgtcctcaa
gtacaagagcgccttactatgcagattgtgcaagaattacaacgcgcaatgggaacagaa
gatgtagcctgcgttatcgatgcaaagcatctctgtgtaaatagtagaggaataagagac
atcgagagcagcacagttactagcgagtttggtggtagatttaaagatgctgctactcgc
agagaatttttagattacatcaagctagacacagatttttaa

DBGET integrated database retrieval system