KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0492Help
Entry
Krodi_0492        CDS       T01484                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00620  Pyruvate metabolism
kdi00630  Glyoxylate and dicarboxylate metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01200  Carbon metabolism
Module
kdi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Krodi_0492
   00630 Glyoxylate and dicarboxylate metabolism
    Krodi_0492
Enzymes [BR:kdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Krodi_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEE18478
UniProt: F4AYL1
Position
complement(561823..563418)
Genome map
AA seq 531 aa AA seqDB search
MAPEINQHALSFSNQVNSYYSEILTDDALDFIKALHENFNAKRLELLRAREQQQLLFDQG
HKPVFPFETQEIREGEWTAGEIPQDLQDRRVEITGPTDRKMVINALNSGAKTFMADLEDS
TAPTWRNVMEGQINLRDAVNKTISYHHPTKDKKYTLNDAVATLLVRPRGWHLNEKHVLVD
GVEVSGSLLDFGLYFFTNVRQLLENGTAPYFYIAKLEHYKEARLWYEVFKFSQDYLNIPE
GTIKCTVLIETITASHQLDEIIYELKDYIVGLNCGRWDYIFSYIKKFRNDPDFLVPNRDQ
VGMTAPFMDAYSKLVIQRCHKRGILAIGGMAAQVPIKNDPSANQAALEKVRKDKEREVIN
GHDGTWVAHPALVQIAMDEFDKHMPTANQQHITRDDVVVTADDLVAIPAGTVTEAGVRKN
INVGILYLNAWLSGQGAVALYHLMEDAATAEISRTQIWHWIKNKAVLEDGKAFTKEYFNE
LFDEEVEKIITEVGSYEIKETQFENAFNLFKELVLAEDFEEFLTTPAYKFL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgaaataaaccaacatgcactaagctttagcaaccaagtaaatagctattat
tcagaaatactaactgatgatgcattagacttcattaaggcacttcatgaaaattttaat
gccaaacgtttagaattattacgtgctagagagcaacaacagttactatttgatcaaggt
cataagcctgtctttccttttgaaacacaagaaataagagaaggcgagtggactgcggga
gagattcctcaagacttgcaagatagaagggtggaaatcacgggacctacagatcgtaag
atggttattaacgcacttaactctggtgcaaaaacctttatggcagacctagaagacagt
actgcgcctacatggagaaatgtgatggaaggtcagattaacttgcgagatgctgtaaat
aaaacgatatcatatcatcaccctactaaggataaaaaatatacactcaatgatgctgtt
gctacattactggtaaggccaagagggtggcaccttaatgaaaaacatgttcttgttgac
ggcgtagaagtgtctgggtctttgttagatttcggattgtatttctttacaaacgtacgt
cagttattagaaaatggtacagcaccctatttctacatagcaaaacttgagcattacaag
gaagcgagactatggtatgaggtttttaaattttctcaagattacttaaatattcctgag
ggaactattaaatgtaccgtactaattgagacgataacggcaagccatcagttggatgaa
attatttatgagttaaaggattatatcgtaggtcttaattgcggtcgctgggattatata
ttctcgtatatcaagaagtttagaaatgatcctgatttcttagttcctaacagggatcaa
gtaggaatgacggcgccttttatggacgcatattctaagttggtaatacaaaggtgtcac
aaacgcgggatcctcgcaataggaggtatggcagcgcaagtgcctattaaaaatgatcct
tcggcaaatcaagcggctttagaaaaagtaagaaaagataaagaacgcgaggtaataaat
ggacacgatggtacatgggttgctcatccagcacttgttcaaattgcgatggatgagttt
gataaacatatgcctacagcaaatcaacagcacattacaagagatgatgttgtggtaaca
gcagatgatctagttgcaattcctgcggggacagttaccgaagctggagtgcgtaaaaat
attaatgtaggaatactctatctcaacgcatggttaagtggtcaaggtgcggtagctctt
tatcacttaatggaagacgctgctactgccgaaatatcaagaacacaaatctggcattgg
ataaaaaacaaagcagtgctggaagatggaaaagcatttacaaaagaatacttcaatgag
ctttttgatgaagaagttgaaaaaatcattactgaagtgggctcttatgaaataaaagaa
actcagtttgagaatgcatttaacctctttaaagaactggtcttagcagaagactttgag
gagtttttaaccaccccagcttataaatttctttag

DBGET integrated database retrieval system