KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0567Help
Entry
Krodi_0567        CDS       T01484                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kdi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:kdi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kdi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644164..645258
Genome map
AA seq 364 aa AA seqDB search
MNIQSISKYLSLCVIGMTISCASVSSTAQNKKPKNIILMIADGTGLSQISASQYYNTQPS
NYDRFKTIGLIKTSSASDLITDSASGATAFSTGLKTYNGAIGVNTDTIAAPTILEDLEKR
GFATGVIATSTITHATPASFYAHQKFRKMELEIAEDIINSGVDFFAGGGRKFFENREDGN
NLVATLESKGYEIYLDRLDPMLSLKKDKNYGFLLADSGMPKFLDGRGSFLYDATKLGIKK
LSQNKKGFFLMVEGSQVDWGGHNNDSEYLISELIDFDTVIGQVLDYAEKDGNTLVIVTAD
HETGGFTLASKAGDYNTIEPSFSTGGHSATMVPVFAYGPGASEFMGIYENTAIHAKMKKL
LKQQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacagtcaatatcaaaatatctatcgctatgtgtaataggtatgaccatatct
tgtgcatctgtaagcagtacagcacaaaataaaaaacctaagaacattatacttatgata
gcagatggtactggtttgagccagatttctgctagtcaatattataatacgcagccgtct
aattatgatcgcttcaaaacaataggactcattaaaacttcttcggcaagtgatttaatt
acagactcggctagtggagctacggctttttctacaggtttaaaaacgtataacggagcc
attggagttaatacagacaccatcgctgcaccaactattcttgaagatttagaaaaaaga
ggttttgctacaggtgttatcgcaacttcaaccatcactcatgcgactcctgctagtttt
tatgctcatcaaaagtttagaaagatggagttagaaattgccgaagatatcattaactct
ggcgttgacttttttgctggtggaggacgtaaattttttgaaaatagagaagatggaaat
aatctcgtagcaacactcgagtctaagggctatgaaatatacttagacagactcgatcct
atgctttcattaaaaaaagataaaaactatggtttcttactagcagacagtgggatgcct
aaatttttagacggtcgtggttctttcttgtatgacgctactaaacttggaatcaagaaa
ctttctcaaaataagaaaggctttttcttaatggtagaaggttctcaagtagactggggc
ggacataataatgatagtgagtacttaataagcgaacttatagactttgacacggtgata
ggtcaagtgcttgattatgctgaaaaggatggcaacacactcgttattgtaactgcagat
catgaaacgggtggctttacacttgcatcaaaagcgggagattataacacgatagaacca
tcattttctacaggcggacacagtgctacgatggtaccagtttttgcttacggacctggc
gcttctgagttcatgggaatctatgagaatactgctattcatgccaaaatgaagaaatta
ctaaaacagcagtag

DBGET integrated database retrieval system