KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0582Help
Entry
Krodi_0582        CDS       T01484                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Krodi_0582
Enzymes [BR:kdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Krodi_0582
Exosome [BR:kdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Krodi_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663730..666924
Genome map
AA seq 1064 aa AA seqDB search
MKFLSMEKKYIIAFDQGTTSTRAIIFDHQGTIKNIAQKELKQHYPKHGWVEHDPIEIFEA
QQATFKEIIETSDISIDEIAAIGITNQRETTVVWDKHTGKPVYNAIVWLDKRTKEICEQL
KSQDLEEYVNKNTGLIIDSYFSGTKVKWILDNVDDAFAKAQQGDLLFGTIDTWLIWKFTN
GAVHATDHSNASRTLLYNIIDLKWDEKMLEALNIPESMLPKVQHSASDFGNIILDGQSIP
ICGVAGDQQASLFGQGGYKSGIAKNTYGTGCFLLMNTGKKPVTSKNGLLTTLCASLPDGK
VKYALEGSIFAGGASVQWLRDKLDLIDHARDTEDICMNTAATDDLYVVPAFAGLGAPYWD
MDAKGAIYGLTLDSGKEDIIKATVDAIAYQTRDVLDAMIEDSGKQMEALRVDGGATANNY
LMQFQSDILNIAVDRPKMLEVTALGAAFLAGIQAGIWNKKDISKIRQVDSIFEPTITEYE
RNKKYTGWKNAVARTKSTTNQMLTTQEDIPMRFSVLDRQRQIARAQKEKFDLIVIGGGVT
GAGIVLDASSRGMNVCLIEKNDFASGTSNKSTKLIHGGLRYLKQMEIGLVQESGSERAIL
HTLAPHLVVPEKMLLPLIEGGTYGKMMTAIGLKVYDFLANVEGDDKRKMLSAEETATREP
LLNKNQLIGGGYYAEYRTDDARLTVELLKKAASFGATIINYCEMKTFKYDEQGKIKSLQC
FDHNTQRNFKLKSQHYVSAAGPWVDLLRKKDHSMNNKYLHLTKGVHIVFSRERFPLTQSI
YFDVPDGRMIFAIPRGRSTYVGTTDTNYSGNLNRVVATQDDATYLLDATNNMFPSANLTI
DDIESNWAGLRPLIHEDGKDPSELSRKDEIFVSDTGLISIAGGKLTGYRKMAQRVIDRVL
KDVPEKKKAHLVKSYTEKIPLTSEPLKNTVEVDIYQQEIKKRLEHVGIVNEYQSWYLATT
YGKQSNTIIDKMSYFLNENPEERLIRAEVWYSIHHEMTNRLADFFVRRTGRLYFDIYSVH
QYRDLVQEDMIRYLGWDEKRVLQENEYLHLLLKDASEYYEEEFE
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctctctatggaaaagaaatatattattgcatttgatcaaggcacaacgagt
actagagctatcatatttgaccatcaaggcaccataaaaaacattgcccaaaaggaactt
aaacaacattacccgaaacacgggtgggtagaacacgatcctatagagatttttgaagca
cagcaagctaccttcaaagagattatcgaaacgtctgacatatctatcgatgagattgct
gcgataggtattactaaccagagagagactaccgtagtctgggataaacatactggaaaa
cctgtctacaatgctattgtatggctggataagcgcactaaagagatttgtgaacaatta
aaatctcaagatctagaagagtatgtgaataagaatacgggactcattatagactcctac
ttctcaggaactaaggtcaagtggatcttagataatgtagatgacgctttcgcgaaagcg
caacaaggcgatttactttttggaactatagacacttggcttatttggaaattcaccaat
ggtgctgtacacgcaacagaccactctaatgccagccgaacattactttataacattata
gacttaaaatgggatgaaaagatgctagaggcattaaacattccagagtcaatgctacct
aaggttcaacatagcgcctcagattttggaaacatcatactagacggccaaagcattcct
atttgtggagttgctggagatcaacaggcttcgctttttggacaaggaggttacaaatct
ggaatagctaaaaacacctacggtaccggttgcttcctacttatgaatactggaaaaaaa
cctgttacctcaaaaaatggactgcttactaccctatgtgctagcttaccagatggtaaa
gttaaatatgcactagaaggctccatatttgcaggaggcgcatctgtacagtggctacgg
gataaacttgacctcatagatcatgcaagagacacagaagatatctgtatgaatacagca
gctacagatgatttatacgtagttcctgcttttgcaggactaggagctccttactgggac
atggatgcaaaaggagcaatttatggattaacactagactcaggcaaagaagatattatc
aaagctacggtagatgcgattgcctatcaaacacgagatgttctagatgcaatgattgaa
gattctggcaaacaaatggaagcgctacgagtagatggcggggccactgcaaataattac
cttatgcaatttcaatcagacattcttaacatagctgtagatcgtccaaagatgctagaa
gttactgcactaggagctgcatttttagctggaattcaagcaggcatttggaacaaaaaa
gatatttctaaaatacgtcaagtagattccatttttgaaccaacgatcactgaatatgag
cgtaacaagaaatataccggctggaaaaatgccgtagcacgcacaaagagcactacaaac
cagatgctcacaacccaagaagatatcccaatgcgtttctctgtacttgacagacagcgc
caaatagctcgtgcacaaaaagaaaaatttgatcttattgttataggtggtggtgttact
ggagctggaattgtacttgacgcttcatctcgtggtatgaatgtatgtcttatagaaaag
aatgattttgcttctggaacaagtaataaatctacaaagcttattcatggtggactgcgt
taccttaagcaaatggagataggcttagtacaagagtcgggaagtgaacgagcaatattg
catacccttgctcctcaccttgttgttccagaaaaaatgctacttccacttatagaaggt
ggcacctatggaaaaatgatgacggcaataggcttaaaagtttatgactttcttgcaaat
gtagagggtgatgataaacgtaaaatgttaagcgcagaagaaactgctaccagagaacct
ttacttaataaaaaccaattaataggtggtggttattatgcagagtatcgcacagatgat
gcacgacttaccgtagagttattaaaaaaagcagccagttttggcgctactattattaac
tactgcgagatgaaaacctttaaatatgatgagcaaggaaaaataaaaagcttacaatgt
tttgaccacaatacacaaagaaattttaaacttaaatcacagcactatgtatctgctgca
ggaccttgggttgatcttttaagaaagaaagaccactccatgaataacaagtatttgcac
cttacaaaaggggtgcacattgtattctctagagagcgttttccattaacccaatctatc
tattttgatgtgccggatggtcgtatgatttttgccatccctcgcggtagatcaacatac
gtaggaacgacggatacgaactatagcggaaacctcaaccgcgttgtggctactcaggat
gatgcaacctacttacttgatgcgactaataatatgtttcctagtgctaacctcaccata
gatgacatagagtctaactgggctggactaagaccacttatacatgaagatggaaaagac
ccttctgaattgagtcgtaaagatgagatttttgtgtctgacacagggttgatctctatt
gctggcggcaaacttactggatatcgtaaaatggcacagcgagttatagatcgcgttctt
aaagatgtgccggagaagaagaaagcacacctcgtaaaatcatacacagaaaaaataccg
cttacctctgagcctttaaaaaacacggtagaagtagatatctaccaacaagagattaaa
aagcgtcttgaacatgtaggtattgtaaatgaatatcaaagttggtacctagcaactacg
tatgggaagcaaagcaataccatcattgataagatgagttatttcttaaatgaaaatcca
gaggagcgcttaatacgtgcagaagtttggtacagcatccatcacgagatgacaaaccgc
cttgctgacttttttgtgcgacgtacgggtagattatattttgatatatactctgtgcat
caatatcgtgacctcgttcaagaggatatgatacgatatttaggttgggatgaaaagaga
gtattgcaggaaaatgaatatctccatcttctcttaaaagatgctagtgaatattatgag
gaagaatttgagtaa

DBGET integrated database retrieval system