KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0750Help
Entry
Krodi_0750        CDS       T01484                                 

Definition
homocysteine S-methyltransferase
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kdi01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kdi00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:kdi00450]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kdi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845542..846540)
Genome map
AA seq 332 aa AA seqDB search
MKSQLTRALQERILVLDGAMGTMLQAYNFSEEDFRGERFKDFHLSVKGNNDMLSLTQPAA
IAEVHRKYFEAGADIVETNTFSSTTIAMADYEMEEYVYDLNYASAKIAKEVAQSFTEKEP
HKPRFVAGSIGPTNKTASMSPDVNDPGYRAVSFEELRVAYKQQVEALLDGGVDMLLVETV
FDTLNAKACLFAIEEVKEERNSGIPIMVSGTITDASGRTLSGQTAVAFLISISHIPLLSV
GFNCALGASQLQPHLEAIANVTNYGISAHPNAGLPNAFGEYDETPEQMATQIKKYIDKNL
VNIVGGCCGTTPAHIKAIAQLVENVTPRKCKL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccaactcacacgcgcattacaagaaagaatcttggttcttgatggggctatg
ggaaccatgctgcaagcatataacttctctgaagaagattttagaggagagcgctttaag
gattttcacctctctgtaaagggtaataatgatatgctgtctctcacacagcctgctgcg
attgcagaggtgcatcgcaagtattttgaagcaggagcagatattgtggagactaatacc
ttctcaagtacgactatcgcaatggcagattatgagatggaggagtacgtgtatgattta
aattatgcttccgcgaaaattgctaaggaagttgctcaatcttttacagaaaaagaaccg
cacaaaccacgatttgtagcaggaagtatagggcctacaaacaaaacagcaagcatgtct
ccagatgtaaatgatccaggctatcgtgcagtgagctttgaagaactcagagtagcttat
aaacaacaagtagaagccttgctagatggaggtgtggatatgttacttgtagaaacggtg
tttgatacccttaatgcaaaagcttgtctttttgcaatagaggaagtaaaggaagaacgc
aactcaggcataccaattatggtgagcggtacgattaccgatgcctcgggacgtacgctt
tctgggcaaacagcagtagcttttttgatttctatctctcatattccactacttagtgtt
ggctttaattgtgcactaggagcttctcaattacaaccacacctcgaagccattgcaaat
gttactaactacgggatttctgctcaccctaatgcgggcttgcctaatgcctttggtgaa
tatgatgaaacaccagaacaaatggcgacgcagattaaaaaatatatcgataaaaacctc
gtgaacatagtgggtggttgttgtggcactacacctgctcacattaaagctattgctcaa
cttgtagagaatgtaacacctagaaaatgtaagctataa

DBGET integrated database retrieval system