KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_0750Help
Entry
Krodi_0750        CDS       T01484                                 

Definition
homocysteine S-methyltransferase
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krodi_0750
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Krodi_0750
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Krodi_0750
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Krodi_0750
Enzymes [BR:kdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Krodi_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845542..846540)
Genome map
AA seq 332 aa AA seqDB search
MKSQLTRALQERILVLDGAMGTMLQAYNFSEEDFRGERFKDFHLSVKGNNDMLSLTQPAA
IAEVHRKYFEAGADIVETNTFSSTTIAMADYEMEEYVYDLNYASAKIAKEVAQSFTEKEP
HKPRFVAGSIGPTNKTASMSPDVNDPGYRAVSFEELRVAYKQQVEALLDGGVDMLLVETV
FDTLNAKACLFAIEEVKEERNSGIPIMVSGTITDASGRTLSGQTAVAFLISISHIPLLSV
GFNCALGASQLQPHLEAIANVTNYGISAHPNAGLPNAFGEYDETPEQMATQIKKYIDKNL
VNIVGGCCGTTPAHIKAIAQLVENVTPRKCKL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccaactcacacgcgcattacaagaaagaatcttggttcttgatggggctatg
ggaaccatgctgcaagcatataacttctctgaagaagattttagaggagagcgctttaag
gattttcacctctctgtaaagggtaataatgatatgctgtctctcacacagcctgctgcg
attgcagaggtgcatcgcaagtattttgaagcaggagcagatattgtggagactaatacc
ttctcaagtacgactatcgcaatggcagattatgagatggaggagtacgtgtatgattta
aattatgcttccgcgaaaattgctaaggaagttgctcaatcttttacagaaaaagaaccg
cacaaaccacgatttgtagcaggaagtatagggcctacaaacaaaacagcaagcatgtct
ccagatgtaaatgatccaggctatcgtgcagtgagctttgaagaactcagagtagcttat
aaacaacaagtagaagccttgctagatggaggtgtggatatgttacttgtagaaacggtg
tttgatacccttaatgcaaaagcttgtctttttgcaatagaggaagtaaaggaagaacgc
aactcaggcataccaattatggtgagcggtacgattaccgatgcctcgggacgtacgctt
tctgggcaaacagcagtagcttttttgatttctatctctcatattccactacttagtgtt
ggctttaattgtgcactaggagcttctcaattacaaccacacctcgaagccattgcaaat
gttactaactacgggatttctgctcaccctaatgcgggcttgcctaatgcctttggtgaa
tatgatgaaacaccagaacaaatggcgacgcagattaaaaaatatatcgataaaaacctc
gtgaacatagtgggtggttgttgtggcactacacctgctcacattaaagctattgctcaa
cttgtagagaatgtaacacctagaaaatgtaagctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system