KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0900Help
Entry
Krodi_0900        CDS       T01484                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00010  Glycolysis / Gluconeogenesis
kdi00620  Pyruvate metabolism
kdi00640  Propanoate metabolism
kdi00680  Methane metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01130  Biosynthesis of antibiotics
kdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_0900
   00620 Pyruvate metabolism
    Krodi_0900
   00640 Propanoate metabolism
    Krodi_0900
  Energy metabolism
   00680 Methane metabolism
    Krodi_0900
Enzymes [BR:kdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Krodi_0900
Lipid biosynthesis proteins [BR:kdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Krodi_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEE18884
UniProt: F4B202
Position
complement(1028087..1029997)
Genome map
AA seq 636 aa AA seqDB search
MSNYHIKGLEEYFQVYRKSVDKPEQFWEEIAEENFVWRKRWDTVLDWDFKKPEVKWFDGA
QLNITENCLDRHLYARGDKTALLFEPNNPDDPAEHITYKDLHERVCKFANVLKAKGVTRG
DRVCIYVPMIPELAVSMLACARIGAVHSVVFAGFSSTALSTRINDASCKMVITSDGSYRG
NKTIDLKSIVDDALENTPSVQSVLVVKRTGGNVVMKEGRDEWIAPLLKEASTECLAETME
AEDSLFILYTSGSTGQPKGMLHTTAGYMVYSAYTFKNVFQYREDDVYWCSADIGWITGHS
YIVYGPLANGATSVLYEGVPSFPDWGRFWEIIDKHQVNQFYTAPTAIRALAKENLSYVEK
YDLSSLKVLGTVGEPINEEAWHWYNDNIGKKKCPIVDSWFQTENGGIMISPIPFATPTIP
TFATLPLPGIQPCLMDEQGKEIKGNQVEGRLCIKFPWPSIARTIWGDHKRYKDTYFSAFD
NMYFTGDGALRDATGYYRITGRVDDVIIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHA
IKGNALYGYVTLKESGEGRDHDNLRKEINQLITEKIGPIAKLNKIQFTNGLPKTRSGKIM
RRILRKIACGDGDNLGDISTLLNPEVVKSVKDNVQL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattaccacataaaaggtctagaagagtattttcaagtctaccgaaagtctgta
gacaagcctgagcaattctgggaagaaattgccgaagaaaactttgtctggcgtaagcgc
tgggataccgtattagattgggattttaaaaagccagaagtaaaatggtttgatggagcc
caattaaatattacagaaaattgtctcgatagacatctctacgctcgtggtgataaaaca
gcattgctctttgagccaaataatcctgatgatcctgccgaacatattacttataaagac
cttcatgagcgcgtgtgcaagtttgcaaatgtgcttaaggctaaaggtgtgacacgcggt
gatcgcgtgtgtatttatgtacccatgataccagaacttgcggtatctatgcttgcatgt
gcgcgtataggagcagtacactctgtggtatttgctggtttttctagtactgcattaagt
actcgtattaatgatgcaagctgtaaaatggttattacgagtgatggctcataccgaggt
aataaaacgattgaccttaaaagtattgtagatgatgcattagaaaatactccatctgtt
cagagcgtacttgttgttaagcgcactggtggcaatgtagtaatgaaagaggggcgtgat
gaatggatagcaccactgttaaaggaagcatcaacagaatgccttgcagaaactatggaa
gcagaggattctttgttcattttatacacttctgggtctacaggccaacctaaggggatg
ttgcacactaccgctggatatatggtgtatagtgcatatacgtttaaaaatgtatttcaa
tatagagaagatgatgtgtactggtgtagtgcagatataggatggattactgggcacagt
tatattgtctacgggccacttgcaaatggtgctacctctgtactttatgagggagttcca
agttttccagactggggacgcttttgggaaataatagataaacatcaagtaaaccaattt
tatacagcacccacagcgataagagcacttgcaaaggagaatttgagttatgtggagaag
tatgatttatcatctcttaaagtattaggaaccgtaggcgaacccataaatgaggaagcc
tggcactggtataatgacaatataggaaagaaaaaatgtccaattgttgatagctggttt
caaacggaaaacggtgggattatgattagtcctataccatttgcaacacctacaataccc
acatttgcaaccttgccattaccaggaatacaaccctgtttaatggacgaacaaggcaaa
gaaatcaaaggaaaccaagtagagggaaggttgtgcattaaatttccatggcctagcata
gctagaacgatatggggagatcacaaaaggtataaagacacgtatttttcggcatttgat
aatatgtattttactggagatggcgctttaagagatgcgacaggttattatagaatcacg
ggacgtgtagatgatgtcattatcgtttctggtcacaacttaggtacagcacctatagaa
gatgctattaatgaacatccagctgttgccgaaagtgctattgtaggttttcctcatgct
attaaaggaaatgctttgtatggttatgtaaccttaaaggaatctggagaaggacgtgac
cacgacaatttacgcaaggagattaaccagcttatcacagaaaaaataggaccgattgct
aagctgaataaaatccaatttacaaacggattacctaaaacgagatctggtaaaatcatg
cgtcgcatactacgtaagattgcctgtggagatggagataatctaggcgatataagtacg
ctacttaatcccgaggtggtgaagagcgtaaaagacaacgtacaattataa

DBGET integrated database retrieval system