KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0900Help
Entry
Krodi_0900        CDS       T01484                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krodi_0900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_0900
   00620 Pyruvate metabolism
    Krodi_0900
   00640 Propanoate metabolism
    Krodi_0900
  Energy metabolism
   00680 Methane metabolism
    Krodi_0900
Enzymes [BR:kdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Krodi_0900
Lipid biosynthesis proteins [BR:kdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Krodi_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028087..1029997)
Genome map
AA seq 636 aa AA seqDB search
MSNYHIKGLEEYFQVYRKSVDKPEQFWEEIAEENFVWRKRWDTVLDWDFKKPEVKWFDGA
QLNITENCLDRHLYARGDKTALLFEPNNPDDPAEHITYKDLHERVCKFANVLKAKGVTRG
DRVCIYVPMIPELAVSMLACARIGAVHSVVFAGFSSTALSTRINDASCKMVITSDGSYRG
NKTIDLKSIVDDALENTPSVQSVLVVKRTGGNVVMKEGRDEWIAPLLKEASTECLAETME
AEDSLFILYTSGSTGQPKGMLHTTAGYMVYSAYTFKNVFQYREDDVYWCSADIGWITGHS
YIVYGPLANGATSVLYEGVPSFPDWGRFWEIIDKHQVNQFYTAPTAIRALAKENLSYVEK
YDLSSLKVLGTVGEPINEEAWHWYNDNIGKKKCPIVDSWFQTENGGIMISPIPFATPTIP
TFATLPLPGIQPCLMDEQGKEIKGNQVEGRLCIKFPWPSIARTIWGDHKRYKDTYFSAFD
NMYFTGDGALRDATGYYRITGRVDDVIIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHA
IKGNALYGYVTLKESGEGRDHDNLRKEINQLITEKIGPIAKLNKIQFTNGLPKTRSGKIM
RRILRKIACGDGDNLGDISTLLNPEVVKSVKDNVQL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattaccacataaaaggtctagaagagtattttcaagtctaccgaaagtctgta
gacaagcctgagcaattctgggaagaaattgccgaagaaaactttgtctggcgtaagcgc
tgggataccgtattagattgggattttaaaaagccagaagtaaaatggtttgatggagcc
caattaaatattacagaaaattgtctcgatagacatctctacgctcgtggtgataaaaca
gcattgctctttgagccaaataatcctgatgatcctgccgaacatattacttataaagac
cttcatgagcgcgtgtgcaagtttgcaaatgtgcttaaggctaaaggtgtgacacgcggt
gatcgcgtgtgtatttatgtacccatgataccagaacttgcggtatctatgcttgcatgt
gcgcgtataggagcagtacactctgtggtatttgctggtttttctagtactgcattaagt
actcgtattaatgatgcaagctgtaaaatggttattacgagtgatggctcataccgaggt
aataaaacgattgaccttaaaagtattgtagatgatgcattagaaaatactccatctgtt
cagagcgtacttgttgttaagcgcactggtggcaatgtagtaatgaaagaggggcgtgat
gaatggatagcaccactgttaaaggaagcatcaacagaatgccttgcagaaactatggaa
gcagaggattctttgttcattttatacacttctgggtctacaggccaacctaaggggatg
ttgcacactaccgctggatatatggtgtatagtgcatatacgtttaaaaatgtatttcaa
tatagagaagatgatgtgtactggtgtagtgcagatataggatggattactgggcacagt
tatattgtctacgggccacttgcaaatggtgctacctctgtactttatgagggagttcca
agttttccagactggggacgcttttgggaaataatagataaacatcaagtaaaccaattt
tatacagcacccacagcgataagagcacttgcaaaggagaatttgagttatgtggagaag
tatgatttatcatctcttaaagtattaggaaccgtaggcgaacccataaatgaggaagcc
tggcactggtataatgacaatataggaaagaaaaaatgtccaattgttgatagctggttt
caaacggaaaacggtgggattatgattagtcctataccatttgcaacacctacaataccc
acatttgcaaccttgccattaccaggaatacaaccctgtttaatggacgaacaaggcaaa
gaaatcaaaggaaaccaagtagagggaaggttgtgcattaaatttccatggcctagcata
gctagaacgatatggggagatcacaaaaggtataaagacacgtatttttcggcatttgat
aatatgtattttactggagatggcgctttaagagatgcgacaggttattatagaatcacg
ggacgtgtagatgatgtcattatcgtttctggtcacaacttaggtacagcacctatagaa
gatgctattaatgaacatccagctgttgccgaaagtgctattgtaggttttcctcatgct
attaaaggaaatgctttgtatggttatgtaaccttaaaggaatctggagaaggacgtgac
cacgacaatttacgcaaggagattaaccagcttatcacagaaaaaataggaccgattgct
aagctgaataaaatccaatttacaaacggattacctaaaacgagatctggtaaaatcatg
cgtcgcatactacgtaagattgcctgtggagatggagataatctaggcgatataagtacg
ctacttaatcccgaggtggtgaagagcgtaaaagacaacgtacaattataa

DBGET integrated database retrieval system