KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1048Help
Entry
Krodi_1048        CDS       T01484                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kdi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1198021..1198701
Genome map
AA seq 226 aa AA seqDB search
MTVLSTKKLKPNQRELLLNAGLQFVEYDAIRTQEVAFTLSRKLKNVIITSQNGVRALLNN
LSSEQLESIKSCFTVGTKTTALLAENGIKVTKTAQNGEELARFIAENYKIESFTYFCGRQ
RRDELPTLLKENNVACEEVVVYETHQITQSFDRTFDGILFFSPSGVNAFAKANKNTRAID
SIAFCIGETTATTARIRFKKVIVSNSTTIESTIAKAVKILKEESRT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtactatccacaaaaaaattaaagcctaaccaacgagagctacttctcaatgca
ggtttacaatttgtggaatatgatgcgatacgcacacaagaggttgcttttacgctttcg
cgaaagcttaaaaatgtaatcatcactagtcaaaatggagtacgcgctttacttaataat
ctttctagtgagcaattagaaagtataaaaagttgttttactgttggcacaaaaacaaca
gcacttttagccgaaaatgggataaaagtgacaaaaacagctcaaaatggagaagaattg
gctcgttttatagcagaaaactacaaaatcgaatcattcacttacttctgcgggagacag
cgcagagatgagttacctacattactcaaagaaaataatgtagcgtgtgaagaagtggtg
gtttatgaaactcatcaaataacacagtcttttgaccgtacatttgatggtatattattt
tttagtccgagtggtgttaacgctttcgcgaaagcgaacaaaaacacacgagcaatagac
agcattgcgttttgcataggcgaaaccactgccacaacggcaagaatacgctttaaaaag
gtaatcgtgtctaattcaacaactatagaaagcaccattgctaaggcggtgaaaatattg
aaagaagaatctagaacttaa

DBGET integrated database retrieval system