KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1571Help
Entry
Krodi_1571        CDS       T01484                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Krodi_1571
Enzymes [BR:kdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Krodi_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784440..1785021
Genome map
AA seq 193 aa AA seqDB search
MITHLSGRLIEKNPTHVVLDCNGVGYFINISLHTFGRLGDSEALKLHTHLQVKEDSHTLF
GFVEVMEREIFRLLLSVSGIGASTARTMLSSLDPHQIKQAIASNDVATIQSIKGIGAKTA
QRVILDLKDKILKVYDMSSESAVQSNTSKEEALSALETLGFARKQAEKVCTAIVKEKPDA
SVETIIKEALKKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcactcacttaagcggaagacttatagaaaaaaatccaactcatgtagtattagac
tgcaatggagtaggatattttattaatatctcattgcatacttttgggcgactaggcgat
agtgaggctttaaagttacacacccacctgcaagttaaagaagatagccacacacttttt
gggtttgtggaggtgatggagcgtgagatctttagactattactgtctgtttctggtata
ggagcaagtacggcaaggacaatgttgtcctctctagatcctcaccagataaaacaagct
attgcatcaaatgatgtagcaaccatacaaagtattaagggaataggagcaaaaacagcc
cagcgagtaatactcgacctaaaggataagatactgaaggtgtacgatatgagtagtgaa
agtgctgtgcaaagcaatactagcaaagaagaggcgttatctgctttagagaccttaggt
tttgcgcgtaagcaagcagaaaaagtctgtacggcgattgtaaaagaaaagccagacgca
agcgtagaaacgatcatcaaggaggcattaaaaaaactgtag

DBGET integrated database retrieval system