KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1800Help
Entry
Krodi_1800        CDS       T01484                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kdi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:kdi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kdi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046451..2048235
Genome map
AA seq 594 aa AA seqDB search
MNFNYVSQNQTHIFMSNPSNKRRLFLRNTLLATGGIILIPNFISCSNDDDLTLNNAIIPD
NLTTSNFELGVASFDPTSNQVIIWTHYTTEAIQATITYELSTDINFNTIVRSGEVITDSS
RDFTVSVEVQDLEAGQKLYYRFANLEDNTVSVIGETITLPSSGLDAVSMGVVSCANYAAG
LFNVYDALGNSDVDIIVHLGDYIYEYGENQYGTNESTVALGRVPEPNHEIVSLDDYRQRY
RQYRSDAGLQLAHQKKPFIAVWDDHEITNDTYQDGAQNHQDNEGDFETRKQAALQAYSEY
LPAMTNDVNIIYRSFKIGDLADLIMLDTRLIGRDKQLDFNNYFGSTGSFDFTAFGEDLVD
PNRSMLGAQQKSWFQSTLANSSSKYQVIGQQVLMGKMFIPAELIITIGTILGEIGATGSV
SAGTTAFFQAQLTELVTLKLRVQANDPTLTAQEIGRVSNTIPYNLDAWDGYLVEREELMN
SFVGKDVVVLAGDTHNAWYNDLTLQDGTAVGKELATASVSSPGFEGILGGDAATITGFQQ
AMTILIDGLNYFNATERGYLKVTLSGSGVQSDWIFIDTIASSNYIAHTGFSESF
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaattatgtgtcacaaaatcaaacacatatttttatgagtaatccatctaat
aaaaggagactttttctaagaaatacattgctagctactggcggtataatattgattcct
aactttataagctgttctaatgatgatgatctaacgttgaataatgcgatcataccagat
aacctaacgacatctaattttgaacttggcgtagcaagttttgaccctactagtaatcag
gttattatctggacacattatactacagaagcaattcaagcaacgattacttatgaatta
agtacagatataaattttaatactatcgtaagaagtggtgaggtgattacagacagtagc
cgtgactttacagttagtgttgaggtacaagatctggaggcaggtcaaaaattatattat
cgctttgcaaacctagaagataacactgtttctgtaataggagagactattactttacca
tcgagtggccttgatgcagtatctatgggagtggtgtcttgtgcaaactatgctgccgga
ctttttaatgtatatgacgcacttggaaattctgacgtagatatcatagtccacttggga
gattatatttacgagtatggagagaatcaatatggaacaaatgagagtacagttgcatta
ggcagagttcccgagcctaatcatgaaatcgtaagtcttgatgattatcgccagagatat
cgtcaatatcgcagtgatgctggactacaattagcacatcaaaaaaaaccgtttattgcc
gtgtgggatgatcacgagattacaaatgacacttatcaagatggagcccaaaatcatcaa
gataacgaaggtgattttgaaactcgcaagcaggcagcactccaagcatatagcgagtat
ttaccagcaatgacaaatgatgtaaatatcatatatagaagttttaagataggagatctt
gcagatttaattatgcttgatactcgattaataggtcgtgataagcaactagattttaat
aactattttgggagtactggtagttttgattttactgcatttggcgaagatctagtagat
cctaaccgtagtatgttaggcgcacaacaaaagagctggttccagagtaccctagcaaat
agttcttcaaagtatcaagtaatagggcagcaggtgcttatgggaaaaatgtttataccg
gcagagcttatcattacaataggaaccattctaggagaaataggagcaacaggatcggtg
tctgccggaactacggctttttttcaagcgcagcttaccgagctggtaacgcttaaacta
cgtgtacaagcaaatgatccaacgcttactgcccaagaaataggacgtgtgtctaatacc
attccttataaccttgatgcttgggatggatacttagtagaacgagaagagttaatgaat
agctttgtggggaaagatgtggttgttcttgcaggagatacacataatgcgtggtataat
gatcttaccctgcaagatggaactgctgttggtaaggagcttgcaacagcttctgttagt
tcgcctggttttgaaggtattttaggaggtgatgcagcgacaatcacagggtttcaacaa
gcaatgaccattcttatagatggacttaattactttaatgcaactgagcgtggctatctt
aaagtaactttaagtggttctggagtgcagtcagattggatttttattgatacgattgct
tcttcaaattatatagcacacacaggtttttctgagagtttttag

DBGET integrated database retrieval system