KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1887Help
Entry
Krodi_1887        CDS       T01484                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kdi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kdi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129189..2130652
Genome map
AA seq 487 aa AA seqDB search
MILLKDILYKVTLETVVGNTAVAITNIYFDSRKVSLNDVFVAVRGTQSDGHDYIAKAVNQ
GALAIICEELPEQIVNGITYVKVADTSSALATIASNFYGNPSANLKLIGITGTNGKTTIA
SLLYQLFQKAGYKTGLLSTVKILVDKTEYKATHTTPDSLTINKYLAEMSEAGVEYCFMEV
SSHGIHQKRTEGLRFEGGIFTNLSHDHLDYHDTFAEYRDVKKKFFDELPKTAFALVNTDD
KNGAVMVQNTKAKKVTYALKSYADYKAQILENQLSGLLLKIQDQEVWVKLIGSFNAYNLL
AIFATAELLGLDQIEALKLLSELESVSGRFQYFISEGNVTAIVDYAHTPDALKNVLETIN
DIRTKNEELITVVGAGGDRDTTKRPKMGHIASALSTKTIITSDNPRSEKPEAIIEQVEAG
VEPINYKKILSITDRKQAIKTACQLANPGDIILIAGKGHETYQEIMGERFDFDDYKIVQE
TLKQLNK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgatactacttaaagacatattatataaagtaacgctagaaactgtggtgggtaacact
gccgtggcaattactaatatttattttgactcgcgcaaagtgtcacttaatgacgtgttt
gttgcagtgcgtggtacgcaaagtgatggtcatgattacatagcaaaagctgtaaatcaa
ggtgcactagcgattatttgtgaggaacttccagagcaaattgtaaacggaataacatac
gttaaggttgcagatacttctagtgcgctggctacaatagcttctaatttttatggaaat
ccttcggctaacttaaagctcattggtattacgggaacaaatggtaagaccactatcgct
agtttgttataccaactgtttcaaaaagcaggttataaaacaggattgctttctacggta
aagattttagtagataagactgagtataaagcgacgcatactactccagatagtttaaca
ataaataaatacctggcagagatgtctgaggcaggtgtagagtattgttttatggaggtg
agttcacatgggattcatcaaaagcgaacagaaggcttgcgttttgagggaggaatattt
acaaacctatctcacgatcatctagattaccatgacacctttgcagaatatagggacgta
aaaaagaaattttttgacgagttaccaaaaactgcttttgcacttgtaaacacagatgac
aagaatggggcggtaatggtgcaaaatactaaggcaaagaaagtaacctacgccttaaag
tcatatgcagattataaagcgcagattttagagaaccaattgtctggattattacttaaa
attcaagatcaagaagtttgggtaaagcttatagggtcatttaatgcttataatttacta
gccatttttgcaactgcagagcttttggggcttgatcaaatagaggcgcttaagctccta
agtgagttagaaagcgtgtcaggtcgatttcagtattttatttctgaagggaatgtgacg
gcaattgtagattatgcacacaccccagatgcacttaaaaatgtgctagagactataaat
gatatccgcactaaaaatgaggagctcattacggtggtaggagctggtggagatagagat
actacaaagcgtcctaaaatggggcatattgcaagtgctctgagtacaaagacaattatc
acaagtgataatccgcgctcagaaaagccagaagcaattatcgagcaagtagaagcaggt
gttgagcctattaactacaaaaagattttatctatcacagatagaaagcaagctataaaa
acagcttgccaacttgcaaatcctggagatataattctaatcgcgggtaaaggtcatgag
acttaccaagagataatgggagagcgatttgattttgacgattataaaatagtacaagaa
acccttaaacaacttaataagtaa

DBGET integrated database retrieval system