KEGG   Dokdonia sp. 4H-3-7-5: Krodi_1887Help
Entry
Krodi_1887        CDS       T01484                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Krodi_1887
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Krodi_1887
Enzymes [BR:kdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Krodi_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129189..2130652
Genome map
AA seq 487 aa AA seqDB search
MILLKDILYKVTLETVVGNTAVAITNIYFDSRKVSLNDVFVAVRGTQSDGHDYIAKAVNQ
GALAIICEELPEQIVNGITYVKVADTSSALATIASNFYGNPSANLKLIGITGTNGKTTIA
SLLYQLFQKAGYKTGLLSTVKILVDKTEYKATHTTPDSLTINKYLAEMSEAGVEYCFMEV
SSHGIHQKRTEGLRFEGGIFTNLSHDHLDYHDTFAEYRDVKKKFFDELPKTAFALVNTDD
KNGAVMVQNTKAKKVTYALKSYADYKAQILENQLSGLLLKIQDQEVWVKLIGSFNAYNLL
AIFATAELLGLDQIEALKLLSELESVSGRFQYFISEGNVTAIVDYAHTPDALKNVLETIN
DIRTKNEELITVVGAGGDRDTTKRPKMGHIASALSTKTIITSDNPRSEKPEAIIEQVEAG
VEPINYKKILSITDRKQAIKTACQLANPGDIILIAGKGHETYQEIMGERFDFDDYKIVQE
TLKQLNK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgatactacttaaagacatattatataaagtaacgctagaaactgtggtgggtaacact
gccgtggcaattactaatatttattttgactcgcgcaaagtgtcacttaatgacgtgttt
gttgcagtgcgtggtacgcaaagtgatggtcatgattacatagcaaaagctgtaaatcaa
ggtgcactagcgattatttgtgaggaacttccagagcaaattgtaaacggaataacatac
gttaaggttgcagatacttctagtgcgctggctacaatagcttctaatttttatggaaat
ccttcggctaacttaaagctcattggtattacgggaacaaatggtaagaccactatcgct
agtttgttataccaactgtttcaaaaagcaggttataaaacaggattgctttctacggta
aagattttagtagataagactgagtataaagcgacgcatactactccagatagtttaaca
ataaataaatacctggcagagatgtctgaggcaggtgtagagtattgttttatggaggtg
agttcacatgggattcatcaaaagcgaacagaaggcttgcgttttgagggaggaatattt
acaaacctatctcacgatcatctagattaccatgacacctttgcagaatatagggacgta
aaaaagaaattttttgacgagttaccaaaaactgcttttgcacttgtaaacacagatgac
aagaatggggcggtaatggtgcaaaatactaaggcaaagaaagtaacctacgccttaaag
tcatatgcagattataaagcgcagattttagagaaccaattgtctggattattacttaaa
attcaagatcaagaagtttgggtaaagcttatagggtcatttaatgcttataatttacta
gccatttttgcaactgcagagcttttggggcttgatcaaatagaggcgcttaagctccta
agtgagttagaaagcgtgtcaggtcgatttcagtattttatttctgaagggaatgtgacg
gcaattgtagattatgcacacaccccagatgcacttaaaaatgtgctagagactataaat
gatatccgcactaaaaatgaggagctcattacggtggtaggagctggtggagatagagat
actacaaagcgtcctaaaatggggcatattgcaagtgctctgagtacaaagacaattatc
acaagtgataatccgcgctcagaaaagccagaagcaattatcgagcaagtagaagcaggt
gttgagcctattaactacaaaaagattttatctatcacagatagaaagcaagctataaaa
acagcttgccaacttgcaaatcctggagatataattctaatcgcgggtaaaggtcatgag
acttaccaagagataatgggagagcgatttgattttgacgattataaaatagtacaagaa
acccttaaacaacttaataagtaa

DBGET integrated database retrieval system