KEGG   Dokdonia sp. 4H-3-7-5: Krodi_1973Help
Entry
Krodi_1973        CDS       T01484                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01130  Biosynthesis of antibiotics
kdi01230  Biosynthesis of amino acids
Module
kdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krodi_1973
Enzymes [BR:kdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Krodi_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEE19956
UniProt: F4AWD7
Position
complement(2224485..2225261)
Genome map
AA seq 258 aa AA seqDB search
MTILDKITADKIKEVALRKSLIPVSQLEQSVLFERDIISLATAVRNGSGIIAEHKRRSPS
KSVINNSLNVQDVARGYEQAGVSGMSVLTDMKYFGGALDDLIIARASTSFPLLRKEFIVD
EYQILEAKAYGADAILLIAATLSRKQIEQFSTFAKSLGLDVLCESHNEEELQKSIMPSVD
MLGINNRNLKTFEVSLETSKELIKQIPDDFTKISESGISSIEAIKELKPHGFHGFLIGEN
FMKTDNPGESAATFINQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactagataaaattacagcagataaaatcaaggaagtagctttaagaaaaagc
cttattcctgtgagtcaattagagcaatcagtgctttttgaacgagatattatttcgctc
gctacggcggtgcgcaatggctctggtattattgcagagcacaaaagaagatcaccaagc
aagtctgttataaataacagcttaaatgtacaagatgtagctcgtggttatgagcaggca
ggtgtaagcgggatgtcggtgttgacagatatgaaatactttggtggtgcactagatgat
ttaattattgctagagcttcgactagttttccgctattacgcaaggaatttatagtagat
gaataccagattcttgaagccaaagcctacggtgcagatgcgatattactgattgcagct
acgctttcgcgaaagcaaatagagcagttttcaacctttgcaaaaagtcttggtctcgat
gtgctttgtgaatctcacaatgaagaagaattacagaagtcgattatgccatctgtagat
atgctaggcataaataaccgaaatcttaagacttttgaagtaagtctagaaacgagtaag
gagctcatcaagcagattccagacgattttacaaaaatctcagaaagcggtattagctcg
attgaagcgattaaagaattaaaaccacacggttttcacgggtttttaattggtgaaaac
tttatgaaaacagataacccaggagagagtgcagcaacttttattaatcagttatga

DBGET integrated database retrieval system