KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1973Help
Entry
Krodi_1973        CDS       T01484                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Krodi_1973
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krodi_1973
Enzymes [BR:kdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Krodi_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224485..2225261)
Genome map
AA seq 258 aa AA seqDB search
MTILDKITADKIKEVALRKSLIPVSQLEQSVLFERDIISLATAVRNGSGIIAEHKRRSPS
KSVINNSLNVQDVARGYEQAGVSGMSVLTDMKYFGGALDDLIIARASTSFPLLRKEFIVD
EYQILEAKAYGADAILLIAATLSRKQIEQFSTFAKSLGLDVLCESHNEEELQKSIMPSVD
MLGINNRNLKTFEVSLETSKELIKQIPDDFTKISESGISSIEAIKELKPHGFHGFLIGEN
FMKTDNPGESAATFINQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactagataaaattacagcagataaaatcaaggaagtagctttaagaaaaagc
cttattcctgtgagtcaattagagcaatcagtgctttttgaacgagatattatttcgctc
gctacggcggtgcgcaatggctctggtattattgcagagcacaaaagaagatcaccaagc
aagtctgttataaataacagcttaaatgtacaagatgtagctcgtggttatgagcaggca
ggtgtaagcgggatgtcggtgttgacagatatgaaatactttggtggtgcactagatgat
ttaattattgctagagcttcgactagttttccgctattacgcaaggaatttatagtagat
gaataccagattcttgaagccaaagcctacggtgcagatgcgatattactgattgcagct
acgctttcgcgaaagcaaatagagcagttttcaacctttgcaaaaagtcttggtctcgat
gtgctttgtgaatctcacaatgaagaagaattacagaagtcgattatgccatctgtagat
atgctaggcataaataaccgaaatcttaagacttttgaagtaagtctagaaacgagtaag
gagctcatcaagcagattccagacgattttacaaaaatctcagaaagcggtattagctcg
attgaagcgattaaagaattaaaaccacacggttttcacgggtttttaattggtgaaaac
tttatgaaaacagataacccaggagagagtgcagcaacttttattaatcagttatga

DBGET integrated database retrieval system