KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_1985Help
Entry
Krodi_1985        CDS       T01484                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Brite
Enzymes [BR:kdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Krodi_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2233713..2235575)
Genome map
AA seq 620 aa AA seqDB search
MGLRFYNEHTRMKITTNQPFYILLLAIFSLSQSCKNEVPKYATQAVANWEASRIIYLQEI
TNAIAGIDTLKQLPVTDAKAKEVFKTLRIAFKKAEPYASYLNPPVGHRVNGPALPIYKED
NEKTMNPVGLQKIEESIYEGETSQGQYDKELTVTYGLLQNLKKNIEKRELNAPRYFTATH
QQLLRVLSFSIAGFDTPVSQLGIAEGAVSLQNLHDTYRASIQSIIQAKNESLDKQFTSQV
ENAITFINENSDYDTFNRYSFTRNHLTPITRSWVAIRKTSELWEGNQSTPFNFDAPTFFE
DDSFNVNFFTPSINKNPTDEQITLGKKLFFDEKLSTSGTMACATCHDPEKAYADGLVVNK
SNTGEALQRNTPTLLNTVFQQNFFADGRSNSIIDQVSAVFTNEKEFNTNVHEFSTRILED
PSYLEMFEKAYGGVSTRNTDVVKAISSYVSTLNSFDSKFDRNMRGDEDTFTKEEQRGMNL
FMGKALCATCHFMPLTNGTVPPFFAETEREVIGVPETVENKELDDDTGYYWRFEAEQHKG
MFKTPTVRNAALTAPYMHNGVYTTLEQVMDFYNQGGGGGLGFDLPHQTLPFDNLKLTNEE
LASLTAFVKTLTDDKVEDNY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttgggattgcgcttttacaatgaacatactcgcatgaaaatcactacaaatcaacctttt
tatatactgctcttagctatcttctccctatcacaaagctgtaagaatgaagtgccgaaa
tacgctacacaagctgtagcaaattgggaagcctcaagaatcatttacctacaagagatt
actaatgctattgctggaatagatacactaaaacaacttcctgtaacagatgcaaaagct
aaagaagttttcaaaacattgcgcatagctttcaaaaaagcagaaccttatgcgtcgtac
ctcaaccctccagtaggacaccgagtaaatggaccagcattacctatttacaaagaggat
aatgagaaaacaatgaatcctgtaggcttacaaaaaatagaagaaagcatttatgagggt
gaaacctctcaaggccaatatgacaaagagcttacggtcacttacggacttttacaaaat
ctcaaaaaaaatattgagaaaagagaactcaatgctcctaggtattttaccgcaactcat
cagcaattactgagagtactgagcttctcaattgcaggttttgatactcccgtgagccaa
ctaggtattgcagaaggtgctgtgtctctacagaacttacatgatacctatcgcgcaagc
attcaatctattattcaagctaagaacgaatcacttgacaagcaattcacttcccaagta
gaaaatgctatcacctttattaatgagaatagtgactacgatacatttaatcgctattcc
tttacacgtaaccacctgacgcctatcacacgcagctgggtagctatcaggaaaactagc
gaactatgggaaggaaaccagagtactccgtttaactttgatgctcctacgttttttgag
gacgatagttttaatgtaaatttcttcactcctagtatcaacaagaatcctacagatgaa
caaatcactttaggaaagaaattattttttgatgaaaagctatccaccagcggtacgatg
gcatgtgcaacttgccacgatccagaaaaagcatatgcagatggtcttgttgtaaataaa
agcaatactggtgaagcactacagagaaatacacccacgctactcaatactgtgttccag
caaaacttttttgcagatggacgttccaattcaattattgatcaagtttctgcagtattt
acaaatgagaaggagtttaatacaaatgttcatgaattttctacaaggattctagaagac
cctagctacttagagatgtttgaaaaagcctacggtggagtatctactcgcaatacagat
gtagtaaaggcaatttcttcatacgtaagcacgctcaatagttttgattcaaaatttgac
cgaaacatgcgaggtgatgaagatacctttacaaaagaagaacaacgaggtatgaatttg
tttatgggtaaagctttatgtgcaacatgtcactttatgcctctaaccaatggaacagta
cctccattttttgcagaaactgagcgtgaggttataggcgttccagaaacagtagaaaac
aaagaacttgatgatgacacaggttattactggcgctttgaagcagaacaacataaaggt
atgtttaagacccccacagtgcgtaatgcagcacttacagctccatatatgcacaatggc
gtatacaccacactagagcaagtaatggatttttacaatcaaggcggtggtggcggacta
ggatttgaccttccacatcaaaccttgccatttgataatcttaagctcacaaatgaggag
cttgcttccttaactgcctttgtaaaaacactcacagatgataaggtagaggataattac
tag

DBGET integrated database retrieval system