KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2080Help
Entry
Krodi_2080        CDS       T01484                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00020  Citrate cycle (TCA cycle)
kdi00640  Propanoate metabolism
kdi00660  C5-Branched dibasic acid metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01130  Biosynthesis of antibiotics
kdi01200  Carbon metabolism
Module
kdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kdi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krodi_2080
   00640 Propanoate metabolism
    Krodi_2080
   00660 C5-Branched dibasic acid metabolism
    Krodi_2080
Enzymes [BR:kdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Krodi_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEE20063
UniProt: F4AZG0
Position
complement(2334575..2335765)
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQGKEILNSFGVRIQRGYVAQTPDEAVAAAERLTEETGTGWHVIKAQVHAGGRGK
GGGVKLAKSLDEVRSIADQIIGMDLVTPQTSAEGKRVHQVLVAEDVYYPGDSEPEEYYMS
VLLNRGTGRNMIMYSTEGGMDIETVAEETPHLIFHEEIDPATGLLPFQARKIAFNLGLSG
AAFKDMTKFVAALYKAYTDSDSSLFEINPVLKTSDDKIMAVDAKVSLDDNALYRRKEYAA
MRDKREENQVEVEAGEKGLNYVDLDGNVGCMVNGAGLAMATMDLIKQSGGEPANFLDVGG
TADAERVEAAFQLILKDPAVKAILVNIFGGIVRCDRVAQGIIDAYKNMGTINVPIIVRLQ
GTNADIAKKLIDDSGLDVQSAIEFQEAADKVQAVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaatatcaaggaaaagagatattaaatagttttggcgtacgtatccag
cgcggttatgtagcacagactccggatgaggctgttgcagctgccgaaagacttactgag
gaaactggtactggatggcacgttattaaagcgcaagttcacgcaggtggtcgtggtaaa
ggtggtggtgtaaagctagcaaagagcctagatgaagtaagatctattgcagatcagatc
atcgggatggatcttgttactccacaaacaagtgcagaaggtaaaagagttcaccaagtg
ctagttgcagaagatgtatactacccaggtgacagcgagccagaagaatattatatgtct
gtactacttaaccgtggtactggtcgcaatatgattatgtattctacagaaggtggaatg
gatattgaaacagtagcagaggaaactccgcaccttatttttcatgaagaaattgatcct
gcaacaggattacttcctttccaagcacgtaaaattgcatttaacttaggattaagtggt
gctgcttttaaagacatgacaaaatttgttgctgctctttataaagcatatacagattct
gatagttcactttttgaaatcaaccctgttcttaaaacaagtgatgataaaattatggca
gtagatgcaaaggtatcactagatgataacgcattataccgtcgtaaggaatatgcagca
atgcgtgacaagcgtgaagaaaaccaagtagaggttgaagctggtgagaaaggacttaac
tatgtagatctagacggaaacgtaggatgtatggtaaacggtgctggacttgcaatggca
actatggaccttatcaagcaatctggtggtgagcctgcaaacttccttgatgtaggaggt
actgcagatgctgagcgtgtagaagctgctttccaattaatacttaaggatccagctgta
aaggcaatcttagtaaacatttttggaggtattgtacgttgtgaccgtgtggcacaaggt
attattgatgcatacaaaaacatgggaactatcaacgtgcctatcattgtacgtttacaa
ggaactaacgcagatatcgcaaagaaattaatagatgattctggacttgatgttcaatct
gctattgaattccaagaagctgcagacaaagtacaggctgtactagcttaa

DBGET integrated database retrieval system