KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2085Help
Entry
Krodi_2085        CDS       T01484                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00010  Glycolysis / Gluconeogenesis
kdi00051  Fructose and mannose metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01130  Biosynthesis of antibiotics
kdi01200  Carbon metabolism
kdi01230  Biosynthesis of amino acids
Module
kdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kdi_M00002  Glycolysis, core module involving three-carbon compounds
kdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_2085
   00051 Fructose and mannose metabolism
    Krodi_2085
   00562 Inositol phosphate metabolism
    Krodi_2085
Enzymes [BR:kdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Krodi_2085
Exosome [BR:kdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Krodi_2085
  Exosomal proteins of bladder cancer cells
   Krodi_2085
  Exosomal proteins of melanoma cells
   Krodi_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE20067
UniProt: F4AZG4
Position
complement(2339311..2340063)
Genome map
AA seq 250 aa AA seqDB search
MRKNIVAGNWKMNNDLGATATLITALKQKKNEGNAEVIIAPTFVNLYSAFDSLSDSNITV
AAQNMHQAESGAFTGEISAGMLKGIGVDTVILGHSERRAYFHESDELLAQKVDSALKNDM
RIIFCFGEELEDRKAGKEENVVGSQLKNALFHLDASAWSNIVLAYEPVWAIGTGETASPE
QAQDMHAFIRKTVAEKYNNEVAENVSILYGGSVKPANAKEIFEKPDVDGGLIGGAALKAD
DFFDIVNAFA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatatcgtcgctggaaactggaaaatgaataatgacctaggtgctacagca
accttaataacagcacttaaacaaaagaagaacgagggaaatgcagaggttattatcgct
cctacatttgtaaacctttacagtgcttttgatagtctttctgactctaatatcactgtt
gctgcgcaaaacatgcatcaagcagaaagtggtgcttttacgggagagatttcggcaggt
atgcttaaaggaataggtgtagacactgtgattttaggacatagtgaacgtcgtgcttat
tttcacgaaagtgatgagctacttgctcaaaaagtagatagcgctcttaaaaacgatatg
agaattatattctgttttggtgaagaactagaagaccgtaaggctggaaaagaagaaaat
gtggtgggtagccaactcaaaaatgcattatttcacttagatgctagcgcatggtcaaat
attgttcttgcttatgagcctgtatgggcaataggaactggagaaacagcatcaccagag
caagcacaagacatgcatgcctttataagaaaaactgttgctgaaaaatataacaatgaa
gtagcagagaatgtatcaatcctttatggaggatctgtaaagcctgctaatgctaaagaa
atttttgagaaaccagatgtagatggtggactcataggtggagctgcacttaaagcagat
gacttttttgatattgtaaatgcgtttgcatag

DBGET integrated database retrieval system