KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2222Help
Entry
Krodi_2222        CDS       T01484                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Krodi_2222
Enzymes [BR:kdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Krodi_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2510784..2512358)
Genome map
AA seq 524 aa AA seqDB search
MTQKNLTYDYIIIGSGFGGSVSALRLSQKGYKVLVVEKGKWYKATDFPKTNWNLRKWLWM
PYLRFFGIMKLSIFKHIAIISGTGVGGGSLVYANTLPTPKSTFFNSGSWSSLNNWEDDLK
PYYKEALRMLGAAQNPSLYDGDKALKAVAKDLNITQKFNPTRVAVFFGTPNKTVKDPYFN
GEGPDRAGCNFCGACMTGCRHNAKNTLDKNYLYLAQKQGATILAENEVYDIQPLDKNDSA
LGYEVSMKRSTRIFGKHQKITTKGVIFSGGVLGTVKLLLALKAKSLPHLSDHLGEDIRSN
NETLISVSTLEKDKNLSKGIAIGSILDTDENSHLEICRYGEGSNAWKLAHLPYVTGSNVF
SRLFKTAIKLIKNPVDYFKIYVSNGWAKNTVVLLFMQTLDSTLRFKRNTLGKMISTVSSG
KAPTPFIPESIALVKSYSKAIKGVSTSFALETLAGIPSTAHILGGAVMGENTESGVIDKD
NKVFGYKNMLVIDGSMISANPGVNPSLTITAIAERAMDQIPNKQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaaaacttaacatacgattacattataataggtagtggttttggtggctct
gtaagtgcactacgcctatcacaaaaaggatataaagtactcgtggttgaaaaaggaaaa
tggtacaaagcaaccgattttcccaaaaccaactggaatctaagaaaatggctctggatg
ccctacctgcggttttttgggattatgaaactatccatattcaagcacattgccattatc
tctggaactggcgtaggtggaggatccctcgtatatgcaaatacattacccactcctaaa
agcactttctttaactctggtagctggagctcgcttaacaattgggaagacgacctaaaa
ccttactataaggaagcattaagaatgctaggtgcagcgcaaaatccttccttatatgat
ggagataaagctctcaaagccgtagcaaaagatttgaatattacacaaaagtttaatcct
acgcgggttgcagtcttctttggaactcctaataaaacagtaaaagacccttattttaat
ggagaaggaccagatcgcgctggatgtaatttttgtggagcttgtatgactggctgccgc
cacaatgcaaaaaacacgcttgacaagaactacctatatcttgctcaaaaacaaggagcc
accatactagccgaaaatgaagtgtatgatatacagccattagataaaaacgacagtgcg
ctaggttatgaagtctctatgaagagaagtacgcgcatctttggtaaacatcaaaaaatc
accactaaaggtgttatcttttctggaggcgtactaggtacagtaaaactcttgctagct
ctaaaagctaagtcactaccgcatctatcagatcatctaggtgaggatatacgtagcaat
aatgaaacactcataagtgtctctacactagaaaaagataaaaacctctccaaaggtatc
gcaataggaagcatacttgacacagatgaaaatagtcatctagaaatatgtagatatgga
gaaggatctaatgcatggaaacttgcgcatttaccttacgtgacaggatcaaacgtattc
tcaagactttttaaaacagctatcaaactaatcaaaaatcctgtagattattttaaaatc
tacgtttcaaatggatgggcaaaaaatactgttgtattattatttatgcaaacgctggat
agtacattacgttttaaaagaaataccttgggaaagatgatatctacagtaagttctgga
aaggctcctaccccatttattccagaatctatagcgcttgtaaaatcatacagtaaggct
attaaaggagtaagtacctcttttgccttagaaacacttgctggaataccatctacagca
cacatactaggcggtgcagttatgggagaaaatacagaaagtggagttatagataaagac
aataaggtttttggctataaaaatatgctcgtgattgatggctctatgatttcggcaaat
cctggcgtaaatccgtcacttaccattacagccattgcagaacgagcgatggatcaaata
ccaaataagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system