KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2557Help
Entry
Krodi_2557        CDS       T01484                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kdi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:kdi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2891919..2893202
Genome map
AA seq 427 aa AA seqDB search
MNKIYNPERSEWESILKRPTQTVDDIEATVNNIFKEVKSDGDVAVAKYTAIFDKVTLNAI
AVSDREIQEAENSLPIELKEAIQLAKGNIEGFHKAQKTSRVAVTTVEGVDCWQEKRPIQK
VGLYIPGGTAPLFSTILMLATPANIAGCKEIVLCTPPDKNGNVNPAILYTAKLSGVTKIF
KVGGIQAIAAMTFGTETVPQVYKIFGPGNQFVTVAKQIATKHGVAIDMPAGPSELLVVAD
DSADTSFVASDLLSQAEHGVDSQVILVATSRKLIDDVEREVEMQMSTLSRKHIAEKAIEN
SKLIYVENDETALALIDEYGPEHFIVCMKNEDFYVDNIMNAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFMKSMTFQKISPKGIQNIGPAIELMAAAEGLDAHKNAVT
LRLKKLQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatctataatccagaaagaagtgagtgggagagtatccttaaaagacctact
caaacagttgatgatattgaagcaactgtaaataatatatttaaagaagttaaatcagac
ggcgatgtagcggttgcaaaatacacggctatttttgataaggtcacgttaaacgccatt
gctgtatcagatcgtgaaatacaagaagccgaaaattctttacctatagagttaaaagaa
gcaatacagctagcaaaaggaaacattgaaggtttccataaagcacaaaaaacgtctaga
gtggcagttactacagtagagggagtagattgctggcaagaaaaaagacctattcaaaaa
gtgggactttatatccctggaggaacagcgccattattttcgacaatattgatgcttgcg
acaccagcaaatattgctggttgtaaagaaattgtattatgtacacctccagataaaaat
ggaaatgtaaatcctgcaattttatacaccgcaaagctgagcggagttactaaaattttt
aaagtaggaggtatccaggcgattgccgcgatgacttttggaacagagactgtaccccaa
gtatataaaatatttggtccaggaaatcagtttgtcacagttgcaaaacaaatagcaaca
aagcatggtgtagcgattgatatgcctgctggaccttcagagttattagtggtggcagat
gattcggcagatacgagttttgtagcatcagacttattaagccaagcagagcacggtgtt
gatagccaagttattttagtagcaacttctcgtaaactcatagatgatgtagaaagagaa
gtggaaatgcaaatgagtacgctttcgcgaaagcatattgcagaaaaagccatcgaaaac
agtaaactaatatatgttgaaaacgatgaaactgctttagcactaattgatgagtacggc
ccggagcattttattgtatgcatgaaaaatgaagacttttatgtggataatatcatgaat
gcaggatctgtatttataggtaattatacgcctgagagtgctggagattatgcatctgga
acaaatcacaccctacctactaatggttatgcaaaacaatacagcggtgtaaatcttgat
agttttatgaagtctatgacctttcaaaaaatatcaccaaaagggattcaaaatataggt
ccagctattgagcttatggctgctgcagaaggacttgatgcacataaaaatgcagtaact
ctcagacttaaaaaattacaataa

DBGET integrated database retrieval system