KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2581Help
Entry
Krodi_2581        CDS       T01484                                 

Definition
magnesium chelatase subunit Chll
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kdi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2916549..2918015
Genome map
AA seq 488 aa AA seqDB search
MNYETINTLGQLKEAGWISRSIKDELREHLIERLQSGKPTFEDIHGYEHTVIPELERAIL
SKHNINLLGLRGQAKTRLARQMVNLLDEWMPIVGGSEINDDPLNPISRYATELIEEKGSD
TPITWIHRSERFAEKLATPDVTVADIVGDVDPIKAANLKLSYADDRVIHYGMIPRANRSI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDMQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPETVAIARTITDQEANLDERQKTKVHVPNLVKDLIEEIGFVARESEFI
DEKSGISARMSITAFQNLMSTAERRMLLSGDETTTIRYSDLLGIVPAITGKVELVYEGEQ
EGAGEVAKILIGDATASLFDDYFPKIEKLTKDDEKDPYEEVLAWFFEQSGFELEDTLTNK
EYELMLDSITPLDDLIKKYQPEIAKEDTYFLKEFILFGLVEFKKLSKYKLTTGMRFNDLY
GSYLSGLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaaacgataaatacactaggacaacttaaagaagccggatggatatctcgt
agcataaaggatgagttacgagaacacttaatagaaagattacaatctggtaagcctaca
tttgaagatatacacggttatgagcacacagttatccctgagcttgagagagctattctt
agtaagcataacataaacttgcttgggctaagaggacaagccaaaacacgtcttgcacgt
caaatggtaaatctacttgatgagtggatgcctatagtaggcggatctgaaattaatgat
gatccacttaatcctatttctagatacgctacggagcttattgaagaaaaaggcagcgac
actccgattacatggattcatcgctctgagcgctttgcagagaaactagcgactccagat
gtaactgttgcagatattgtaggggatgtagatcctataaaagcagcaaatttaaaactg
agctatgcagatgatcgcgtgatacattatgggatgattcctcgtgcaaacagatcaatt
tttgtaatcaatgaattaccggatttacaagcaagaatacaagtggcgctatttaatatc
ctacaagaaggagatattcaaatacgcggattcaaattaagattgccacttgacatgcaa
tttgtatttactgcaaatccagaagattatacaaatagaggaagcattgtaacaccgctt
aaagaccgtataggttcgcaaatacttacccactatccagaaacagtagctattgcaaga
accataacagatcaagaagcaaatcttgacgagcgtcaaaaaacgaaggttcatgttcct
aatctagtgaaagacttaattgaagaaataggatttgttgctcgtgaaagtgagtttata
gatgaaaagagtgggataagtgccagaatgagtattactgcttttcaaaacctaatgagt
actgcagaacgtcgtatgttgctatcgggagatgaaactactacgatacgttactcagat
ctactaggaatcgttcctgcaattacagggaaggtagaacttgtttacgaaggggaacaa
gaaggtgcaggagaggttgccaaaattttaataggcgatgcaacagcttctttgtttgat
gactatttccctaagattgaaaaactaactaaggatgatgagaaagatccttatgaagaa
gtactagcatggttttttgagcaaagcggttttgagctagaagatacgcttaccaataaa
gaatatgaacttatgctagatagtattacacctcttgatgatttaatcaagaaatatcaa
cctgaaatagcaaaagaggatacatatttcttaaaagaatttatacttttcggactagta
gaattcaagaaattgtcaaaatataagcttacgactggtatgcgttttaatgatctttat
gggtcttacttgtcaggattagcctaa

DBGET integrated database retrieval system