KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2630Help
Entry
Krodi_2630        CDS       T01484                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Krodi_2630
Enzymes [BR:kdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Krodi_2630
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Krodi_2630
Lipid biosynthesis proteins [BR:kdi01004]
 Fatty acid synthase
  Component type
   Krodi_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2961314..2962063)
Genome map
AA seq 249 aa AA seqDB search
MFSIKLTQWSLKSPQSLQYIITKFSIVIMSISFASCNSNTATKEQVVQEPTIAVSQEEIH
DSRKSLLFFGDSITAGYGLDDTNDAYPALIQNKIDSLNLDYEVINSGLSGETSAGGRSRI
DWILNQPIDVFVLELGANDGLRGVAVEETRENLQAIIDAVRAKSPSTTIVLAGMQLPPNF
GQVYTANFKSMFIELATSNDMAFIPFILKDVGGIKALNQNDGIHPTEEGHEIVAETVWET
LEELLTKKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttctctataaaattaacacaatggtctttaaaaagcccacagtcgctacaatacatt
atcacaaagtttagtattgttataatgtcgatttctttcgcttcatgtaacagtaatacg
gctacaaaagaacaagttgtacaagaacccacaatagcggtttctcaagaagaaatacat
gattcaaggaaatctctgctcttctttggagatagtattactgctggctatggcctagat
gatacaaatgatgcctatccagcactcatccaaaacaaaatagacagtctaaacttagat
tatgaggtgataaactcaggcttaagcggagaaaccagtgcaggtggtcgaagcaggata
gattggatactaaatcaacctatagatgtatttgtgctagaacttggtgcaaatgacggc
ttacgaggcgttgctgtagaagaaaccagagaaaaccttcaagctattattgatgctgta
cgtgccaaaagtccgtctactactattgttcttgctggaatgcaactacctcctaatttt
ggtcaagtatataccgcaaattttaaaagtatgtttattgagcttgcaacgtcaaatgat
atggcttttattccatttattttaaaagatgtaggtggtattaaagctcttaatcaaaat
gatggtattcatcctacagaagaaggtcatgagattgttgccgaaactgtctgggaaacc
ctagaagagcttctcaccaaaaagcaataa

DBGET integrated database retrieval system