KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2702Help
Entry
Krodi_2702        CDS       T01484                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:kdi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:kdi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3043436..3044191
Genome map
AA seq 251 aa AA seqDB search
MLIIFFIVILWYSGLFFQSFFLHRYAAHQTFTMSKTTEKITFILTWLFQGPSYLSAYGYG
IMHRMHHAYTDTEKDPHSPSYDANLFAMMWKTKTIYQDINNDRIEVDPKFKKNVPQWKSF
DTFASSRLSRLLWVGLYIAFFAVFATAWWQWLLLPVAFAMAPIHGVIINWFGHILGYTNF
KTKDTSKNLFRFDFLMMGEAYHNNHHKFAARPNFGGIHWYEIDVTYVIMKVLHRTGVIKM
KPITIDVHSHH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcttataatattctttatagtaatcctctggtatagcgggttattttttcagtcattc
tttctccatagatatgcagctcaccagacatttacaatgtctaaaaccacagaaaaaatc
acatttatattaacctggctttttcaaggaccaagttacctaagtgcttatggttatggg
attatgcaccgcatgcatcatgcttatacagacacagaaaaggatcctcactccccttct
tatgatgcaaacctttttgcaatgatgtggaagactaagactatttatcaagatataaat
aacgatcgtattgaggtagaccctaagtttaagaaaaacgtaccacagtggaagagtttt
gacactttcgctagctcgcgtctatcacgcttactttgggtaggtttatatatcgctttc
tttgccgtatttgcaacagcatggtggcagtggttattgttacctgttgcctttgcgatg
gctcctatacacggagtgattatcaactggtttggtcacattctagggtatacaaatttc
aaaactaaagacacttctaagaatttattccgctttgacttcttaatgatgggagaagca
tatcataacaaccaccacaaatttgcggctaggcctaactttggagggatacactggtat
gagattgatgttacttatgtaatcatgaaagtgcttcaccgcacaggagtgataaaaatg
aaacccatcacgatagacgtgcactcacaccattaa

DBGET integrated database retrieval system