KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2702Help
Entry
Krodi_2702        CDS       T01484                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Krodi_2702
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Krodi_2702
Enzymes [BR:kdi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Krodi_2702
Lipid biosynthesis proteins [BR:kdi01004]
 Desaturase
  First
   Krodi_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3043436..3044191
Genome map
AA seq 251 aa AA seqDB search
MLIIFFIVILWYSGLFFQSFFLHRYAAHQTFTMSKTTEKITFILTWLFQGPSYLSAYGYG
IMHRMHHAYTDTEKDPHSPSYDANLFAMMWKTKTIYQDINNDRIEVDPKFKKNVPQWKSF
DTFASSRLSRLLWVGLYIAFFAVFATAWWQWLLLPVAFAMAPIHGVIINWFGHILGYTNF
KTKDTSKNLFRFDFLMMGEAYHNNHHKFAARPNFGGIHWYEIDVTYVIMKVLHRTGVIKM
KPITIDVHSHH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcttataatattctttatagtaatcctctggtatagcgggttattttttcagtcattc
tttctccatagatatgcagctcaccagacatttacaatgtctaaaaccacagaaaaaatc
acatttatattaacctggctttttcaaggaccaagttacctaagtgcttatggttatggg
attatgcaccgcatgcatcatgcttatacagacacagaaaaggatcctcactccccttct
tatgatgcaaacctttttgcaatgatgtggaagactaagactatttatcaagatataaat
aacgatcgtattgaggtagaccctaagtttaagaaaaacgtaccacagtggaagagtttt
gacactttcgctagctcgcgtctatcacgcttactttgggtaggtttatatatcgctttc
tttgccgtatttgcaacagcatggtggcagtggttattgttacctgttgcctttgcgatg
gctcctatacacggagtgattatcaactggtttggtcacattctagggtatacaaatttc
aaaactaaagacacttctaagaatttattccgctttgacttcttaatgatgggagaagca
tatcataacaaccaccacaaatttgcggctaggcctaactttggagggatacactggtat
gagattgatgttacttatgtaatcatgaaagtgcttcaccgcacaggagtgataaaaatg
aaacccatcacgatagacgtgcactcacaccattaa

DBGET integrated database retrieval system