KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2834Help
Entry
Krodi_2834        CDS       T01484                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Krodi_2834
Enzymes [BR:kdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Krodi_2834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3213299..3215035
Genome map
AA seq 578 aa AA seqDB search
MKSKIPNGVMFNAYPDSIGKKLRDTVTLLQRPELKDVFSLFYVLPTFFNSDLDRGFSIVD
YNINTELVSQEDLDALKKLDVMLKFDIVLNHLSVGSPQFKDILEKGDASPYKDFFIDWNA
FWEGNTASYNNGVAVPKKEYLNKLFMRKPGLPVLKVLFPDGTERPYWNTFYQQITYHEIT
IEDLETLNELATEDKKDTVALVNNAIASGYDISEVRFRESVTPHISKLVKIVEQQRSYLG
QMDVNGNSEMVWDFYDETLKKVADFGCKILRLDAFAYLHKEVGETNFFNKPGTWTYLERI
NQIAKKYDLTLLPEIHSEYGLGLHDEVASEGYQIYDFFFPGLVIHTIETGSASALLSWAK
EVIAKGYKTVNMLGCHDGIPVLDLKGITDAQGNNHPGLLKDTEIEHIIETILSRGGRVKN
IYDPEGNKISYYQVNATFYSALGEDDRKLLLARALQVFMPGIPQVWYLDLFAGKNDYEAA
DAAGTGGHKEINRTTLTQEDIERGLEKPVVLKQLELLRLRNTAAAFSGTMTIEIEDVSQL
EISWKQDEDTATLKANLTDYSFTVTHVTNGEETVIANS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctaagattcccaacggagtaatgtttaatgcttatccagatagcataggtaaa
aagttacgcgataccgttaccttattgcagcgtccagaacttaaggatgtcttctcattg
ttttatgtactacctactttttttaacagtgatctagaccgcggtttttctattgttgat
tataacatcaatacggagcttgtctcgcaagaggatctcgatgcgcttaaaaagctagat
gttatgcttaagtttgacattgtgcttaatcacctttctgtaggctcaccacagtttaag
gatattttagaaaagggtgatgcatcaccatacaaagacttttttattgactggaatgcc
ttttgggagggcaatacagcttcttacaacaacggcgtagcagttcccaaaaaggaatat
ctcaacaaattatttatgcgcaagccaggtctacctgtgcttaaagtattatttcccgat
ggcacagaacgaccatactggaacacattttatcagcaaattacatatcatgaaataacc
attgaggatttagaaactttaaacgaactagcaaccgaggataaaaaggataccgtagca
cttgtaaataatgcgattgctagtgggtatgatatttctgaagtacgctttcgcgaaagc
gtaacacctcacatctcaaagcttgtaaagattgtagagcaacaacgttcttatctaggg
caaatggatgtgaatggaaactcggaaatggtgtgggatttttatgatgagacactaaaa
aaagtagccgattttgggtgtaaaattttgcgccttgatgcctttgcttatttgcataaa
gaagtgggcgaaactaactttttcaacaaaccaggtacgtggacatatctagagcgtatc
aaccagattgctaaaaaatatgatcttaccttacttcctgagattcactcagaatatgga
ttaggcctacacgacgaagttgcttctgaaggatatcaaatctatgatttctttttccct
ggacttgttattcacaccattgaaactggaagtgctagcgctcttttgtcatgggcaaaa
gaagtcattgccaaaggttacaaaaccgtaaatatgctaggctgtcacgatgggattccc
gtgctcgaccttaaaggaattacagatgcgcaaggaaataaccatccaggactcctcaaa
gacaccgaaattgaacatatcattgaaacgattttgagtcgtggtgggcgtgtcaagaat
atctatgatcccgaaggaaacaaaatctcatactatcaagtaaacgctacgttttacagc
gccttaggcgaagatgaccgcaagctcttgcttgctcgtgcactacaagtatttatgcct
ggaatcccgcaggtttggtacttagacctttttgcaggaaagaatgattatgaggcggca
gacgctgctggaaccggaggtcataaagaaattaaccgcactaccttaacacaagaagat
attgagcgcggactagaaaaacctgtggtcttaaaacaactagaattactacgtttacgt
aacacagctgctgctttttctggtacaatgaccatagaaattgaagatgttagtcagctg
gaaattagttggaaacaggacgaggatacagccaccttaaaagcaaatctcactgactac
tcatttacggtcactcatgttacaaatggtgaagaaacggtcattgctaatagctaa

DBGET integrated database retrieval system